KEGG   Pongo abelii (Sumatran orangutan): 100456753Help
Entry
100456753         CDS       T01416                                 

Gene name
CHRM4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:pon04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:pon04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:pon04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 479 aa AA seqDB search
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSIKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASKWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccaacttcacacctgtcaatggcagctcgggcaatcagtccgtgcgcctggtcacg
tcatcatcccacaatcgctatgagacggtggaaatggtcttcattgccacagtgacaggc
tccctgagcctggtgactgtcgtgggcaacatcctggtgatgctgtccatcaaggttaac
aggcagctgcagacagtcaacaactacttcctcttcagcctggcgtgtgctgatctcatc
ataggcgccttctccatgaacctgtacaccgtgtacatcatcaagggctactggccccta
ggtgccgtggtctgcgacctgtggctggccctggactacgtggtgagcaatgcctccgtc
atgaaccttctcatcatcagctttgaccgctacttctgcgtcaccaagcccctcacctac
cctgcccggcgcaccaccaagatggcaggcctcatgattgccgctgcctgggtactgtcc
ttcgtgctctgggcgcctgccatcttgttctggcagtttgtggtgggcaagcggacggtg
cccgacaaccagtgcttcatccagttcctgtccaacccagcagtgacctttggcacagcc
attgctgccttctacctgcctgtggtcatcatgacggtgctgtacatccacatctccctg
gccagtcgcagccgagtccacaagcaccggcccgagggcccaaaggagaagaaagccaag
acgctggccttcctcaagagcccactaatgaagcagagcatcaagaagcccccgcccggg
gaggccgcccgggaggagctgcgcaatggcaagctggaggaggccccccctccggcgctg
ccaccaccaccgcgccccgtggctgataaggacacttccaatgagtccagctcaggcagt
gccacccagaacaccaaggaacgcccagccacagagctgtccaccacagaggccaccacg
cccgccatgcccgcccctcccctgcagccgcgggccctcaacccagcctccaaatggtcc
aagatccagattgtgacgaagcagacaggcaacgagtgtgtaacagccattgagattgtg
cctgccacgccggctggcatgcgccctgcggccaacgtggcccgcaagttcgccagcatc
gctcgcaaccaggtgcgcaagaagcggcagatggcggcccgggagcgcaaagtgacacga
acgatctttgccattctgctagctttcatcctcacctggacgccctacaatgtcatggtc
ctggtgaacaccttctgccagagctgcatccctgacacggtgtggtccattggctactgg
ctctgctacgtcaacagcaccatcaaccctgcctgctatgctctgtgcaacgccaccttt
aaaaagaccttccggcacctgctgctgtgccagtatcggaacatcggcactgccaggtag

DBGET integrated database retrieval system