KEGG   Pongo abelii (Sumatran orangutan): 100456786Help
Entry
100456786         CDS       T01416                                 

Gene name
MTOR
Definition
mechanistic target of rapamycin (serine/threonine kinase)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Acute myeloid leukemia
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:pon04012]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:pon04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:pon04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:pon04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:pon04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:pon04920]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:pon04919]
Human Diseases; Cancers; Pathways in cancer [PATH:pon05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:pon05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:pon05205]
Human Diseases; Cancers; Glioma [PATH:pon05214]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:pon05221]
Human Diseases; Cancers; Prostate cancer [PATH:pon05215]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:pon04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 2630 aa AA seqDB search
MRPDAEGNPSSAAPDRAAGKAGGGAGGLKRRYRCWRRQLRPWSKPREPQGKMLGTGPAAA
TTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTLFYDPQXN
HHIFELVSSSDANERKGGILAIASLIGSKVGNATRIGRFANYLRNLLPSNDPVVMEMASK
AIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQ
PFFDNIFVAVWDPKTGYPEGAVAALCSLLILTTQPXAEGEAEPQWYRHTFEEAEEGIXXD
LGPKSKGMNRDDRIHVGALLILNELVRISSMGGRGEKPRQRGRLREEMEEITQQQLVHDK
YCKDLMGFGTKPRHITPFPSFQAVQPQQSNALVGLLGYSSHQGLMGFGVSPSPAKSTLVE
SRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMN
HVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRESAMQG
GTPTVFTCISMLARAMGARASQQGLSRELLEPMVAVGLSPALTAVLYDLSRQIPQLKKDI
QDGLLKMLSLVLMHKPLRHPGMPKGLAHQLAYSWASRPSLEASDVGSITLALRTLGSFEF
EGHSLTQFVRHCADHFLNSEHNEIRMEAARTCSRLLTPILSTLISWPCSCGLCSEPQCKW
VADVLSTTSSLHCSCRPXHSSYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELA
ICTVGRLFSVSPSFLFPVVSFSSLQILTELEHSGNWKNSKSESARMLGHLVSNAPRLIRP
YMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMGHAPG
IPLCWPKDQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLG
LLGALDPYKHKVLTLGMIDQSRDASAVSLSGXSKSSQDSSDYSTSEMLVNMGNLPLDEFY
PAVSMVALMPDLRDQSLSHHHTMVVQANITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDG
AIREFLFQQLGMLVSFVKCLLCHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVAL
GGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKVITGWQSSCFGANLDDYLHLLLPPIVKL
FDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLV
FQLGKKVSLSYICFIPMVNKVLVRHRINQQVFPINLWLQGYTLADEEEDPLIYQHRMLRS
GQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPS
LRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLN
LAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISI
NNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLG
RMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRD
THDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSEL
EEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASL
CGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQH
FVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAA
TEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATAT
TTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNN
LQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQ
LLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRV
AILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLM
EAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELA
VPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVM
QLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKI
LLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTN
YTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRL
TRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGN
KRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQ
IINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7893 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccggatgcagaagggaatcctagcagcgccgcaccggatagggcagcggggaag
gcgggcggtggggcagggggcctgaagcggcggtaccggtgctggcggcggcagctgagg
ccttggtcgaagccgcgcgaacctcagggcaagatgcttggaaccggacctgccgccgcc
accaccgctgccaccacatctagcaatgtgagcgtcctgcagcagtttgccagtggccta
aagagccggaatgaggagaccagggccaaagccgccaaggagctccagcactatgtcacc
atggaactccgagagatgagtcaagaggagtctactctcttctatgacccacaatagaac
catcacatttttgaattggtttccagctcagacgccaatgagaggaaaggtggcatcttg
gccatagctagcctcatagggagtaaggtggggaatgccacccgaattggcagatttgcc
aactatcttcggaacctccttccctccaatgacccagttgtcatggaaatggcatccaag
gccattggccgtcttgccatggcaggggacacttttactgctgagtacgtggaatttgag
gtgaagcgagccctggaatggctgggtgctgaccgcaatgagggccggagacatgcagct
gtcctggttctccgtgagctggccatcagcgtccctaccttcttcttccagcaagtgcag
cccttctttgacaacatttttgtggccgtgtgggaccccaaaacaggctaccctgaggga
gctgtagccgccctttgttcccttctgattctcaccacccagccgtaagccgaaggagag
gcagagcctcagtggtacaggcacacatttgaagaagcagaggaagggatttgatgagac
cttggaccaaagagcaagggcatgaatcgggatgatcggatccacgttggagccttgctg
atccttaacgagctggtccgaatcagcagcatgggagggagaggtgagaagccacggcag
aggggacgtctgagagaagaaatggaagaaatcacacagcagcagctggtacacgacaag
tactgcaaagatctcatgggcttcggaacaaaacctcgtcacattacccccttccccagt
ttccaggctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctct
caccaaggcctcatgggatttggggtctcccccagtccagctaagtccaccctggtggag
agccggtgttgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctg
aaatgcaggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgc
ttggctgcattccgaccttctgccttcacagatacccagtacctccaagataccatgaac
catgtcctaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctgggg
ctactttccgtggctgtgaggtctgaatttaaggtctatttgcctcgcgtgctggacatc
atccgagcggccctgcccccaaaggacttcgcccataagcgtgaaagtgcaatgcaaggt
gggacgccaacagtcttcacttgcatcagcatgctggctcgagcaatgggggccagggca
tcccagcaaggattatcaagggagctactggagcccatggttgctgtgggcctcagccct
gccctcactgcagtgctctacgacctgagccgtcagattccacagctaaagaaggacatt
caagatggcttactgaaaatgctgtccctggttcttatgcacaaacccctccgccaccca
ggcatgcccaagggcctggcccatcagctggcctactcctgggcctcacgaccctccctt
gaggccagcgatgtgggcagcatcactcttgccctccgaacgcttggcagctttgaattt
gagggccactctctgacccaatttgttcgccactgtgcggatcatttcctgaacagtgag
cacaatgagatccgcatggaggctgcccgcacctgctcccgcctgctcacacccatccta
tccacgctcatcagttggccatgctcatgtggtctatgctcagagccgcagtgcaagtgg
gtggcagatgtgcttagcacaactagctcgctccattgctcttgcagaccctgacattca
agctattgtgtcttggcgtccctggacgagcgctttgatgcacacctggcccaggcggag
aacttgcaggccttgtttgtggctctgaatgaccaggtgtttgagatccgggagctggcc
atctgcactgtggggcgtctattctcagtatccccttcatttcttttccctgtggtctcc
ttttcttccctacagattttgacagagttggagcacagtgggaattggaagaactcaaag
agcgagagtgcccgcatgctggggcacctggtctccaatgccccccgactcatccgcccc
tacatggagcctattctgaaggcattaattttgaaactgaaagatccagaccctgatcca
aacccaggtgtgatcaataatgtcctggcaacaataggagaattggcacaggttagtggc
ctggaaatgaggaaatgggttgatgaactttttattatcatcatgggacatgctccaggg
attcctctttgttggccaaaagaccaggtggctctgtggaccctgggacagttggtggcc
agcactggctatgtagtagagccctacaggaagtaccctactttgcttgaagtgctactg
aattttctgaagactgagcagaaccagggtacacgcagagaggccatccgtgtgttaggg
cttttaggggctttggatccttacaagcacaaagtgttaacattaggcatgatagaccag
tcccgggatgcctctgctgtcagcctgtcaggnnaatccaagtcaagtcaggattcctct
gactatagcactagtgaaatgctggtcaacatgggaaacttgcctctggatgagttctac
ccagctgtgtccatggtggccctgatgccggatcttcgagaccagtcactctctcatcat
cacaccatggttgtccaggccaacatcaccttcatcttcaagtccctgggactcaaatgt
gtgcagttcctgccccaggtcatgcccacgttccttaatgtcattcgagtctgtgatggg
gccatccgggaatttttgttccagcagctgggaatgttggtgtcctttgtgaagtgtctc
ttatgccacatcagaccttatatggatgaaatagtcaccctcatgagagaattctgggtc
atgaacacctcaattcagagcacgatcattcttctcattgagcaaattgtggtagctctt
gggggtgaatttaagctctacctgccccagctgatcccacacatgctgcgtgtcttcatg
catgacaacagcccaggccgcattgtctctatcaaggtgattactggctggcaatccagc
tgttttggcgccaacctggatgactacctgcatttactgctgcctcctattgttaagttg
tttgatgcccctgaagctccactgccatctcgaaaggcagcgctagagactgtggaccgc
ctgacggagtccctggatttcactgactatgcctcccggatcattcaccctattgttcga
acactggaccagagcccagaactgcgctccacagccatggacacgctgtcttcacttgtt
tttcagctggggaagaaggtaagtctctcttatatatgtttcattccaatggtgaataaa
gttcttgtgcgacaccgaatcaatcaacaggtgtttcctataaatctttggttgcaggga
tacacacttgctgatgaagaggaggatcctttgatttaccagcatcggatgcttaggagt
ggccaaggggatgcattggctagtggacccgtggaaacaggacccatgaaaaaactgcac
gtcagcaccatcaacctccaaaaggcctggggcgctgccaggagggtctccaaagatgac
tggctggaatggctgagacgactgagcctggagctgctgaaggactcatcatcgccctcc
ctgcgctcctgctgggccctggcacaggcctacaacccgatggccagggatcttttcaat
gctgcatttgtgtcctgctggtctgaactgaatgaagatcaacaggatgagctcatcaga
agcatcgagttggccctcacctcacaagacatcgctgaagtcacacagaccctcttaaac
ttggctgaattcatggaacacagtgacaagggccccctgccactgagagatgacaatggc
attgttctgctgggtgagagagctgccaagtgccgagcatatgccaaagcactacactac
aaagaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcatt
aataataagctacagcagccggaggcagcggccggagtgttagaatatgccatgaaacac
tttggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgcc
cttgtggcctatgacaagaaaatggacacgaacaaggatgatccagagctgatgctcggc
cgcatgcgctgcctcgaggccctgggggaatggggtcaactccaccagcagtgctgtgaa
aagtggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagct
gcatggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggac
acccatgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttg
gcacaacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggca
ggagagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctg
gaggaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctgg
tgggagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtg
cggtcccttgtggtcagccctcacgaagacatgagaacctggctcaagtatgcaagcctg
tgcggcaagagtggcaggctggctcttgctcataaaaccttagtgttgctcctgggagtt
gatccatctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacctatgcc
tacatgaaaaacatgtggaagagtgcccgcaagatcgatgccttccagcacatgcagcat
tttgtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcat
aagcaggaactgcacaagctcatggcccgatgcttcttgaaacttggagagtggcagctg
aatctacagggcatcaatgagagcacaatccccaaagtgctgcagtactacagcgccgcc
acagagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaacttcgaa
gctgtgctacattacaaacatcagaaccaagcccgcgacgagaagaagaaactgcgtcat
gccagcggggccaacatcaccaatgccaccactgccgctaccacagccgccactgccacc
accaccgccagcaccgagggcagcaacagtgagagcgaggccgagagcaccgaaaacagc
cccaccccatcaccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatg
tatacggtgcctgctgtccagggcttcttccgttccatctccttgtcacgaggcaacaac
ctccaggatacactcagagttctcaccttatggtttgattatggtcactggccagatgtc
aacgaggccttagtggagggggtgaaagccatccagattgatacctggctacaggttata
cctcagctcattgcaagaattgatacgcccagacccttggtgggacgtctcattcaccag
cttctcacagacattggtcggtaccacccccaggccctcatctaccccctgacagtggct
tctaagtctaccacgacagcccggcacaatgcagccaacaagattctgaagaacatgtgt
gagcacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgagtg
gccatcctctggcatgagatgtggcacgaaggcctggaggaggcgtctcgtttgtacttt
ggggaaaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaa
cggggtccccagactctgaaggaaacatcctttaatcaggcctatggtcgagatttaatg
gaggcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaa
gcctgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcagctcaca
tccttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaattggct
gtgccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtct
ttgcaagtcatcacatctaagcagaggccccggaaattgacacttatgggcagcaacggg
catgagtttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgtgtgatg
cagctcttcggcctggttaatacccttctggccaatgacccaacatctcttcggaaaaat
ctcagcatccagagatatgctgtcatccctttatcgaccaactcgggcctcattggctgg
gtcccccactgtgacacactgcacgccctcatccgggactacagggagaagaagaagatc
cttctcaacatagagcatcgcatcatgttgcggatggctccggactatgaccacttaact
ctgatgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggacgacctg
gccaagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaagaaccaat
tatacccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagataga
cacccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggg
gactgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagacta
acaagaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcaca
tgccacacagtgatggaggtgctgcgagagcacaaggacagtgtcatggccgtgctggaa
gcctttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaac
aagcgatccagaacgaggacggattcctactctgctggccagtcagtcgaaattttggac
ggtgtggaacttggagagccagcccataagaaaacggggaccacagtgccagaatctatt
cattctttcattggagatggtttggtgaaaccagaggccctaaataagaaagctatccag
attattaacagggttcgagataagctcactggtcgggacttctctcatgatgacactttg
gatgttccaacgcaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgc
cagtgctatattggctggtgccctttctggtaa

DBGET integrated database retrieval system