KEGG   Pongo abelii (Sumatran orangutan): 100456786Help
Entry
100456786         CDS       T01416                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin (serine/threonine kinase)
  KO
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Acute myeloid leukemia
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100456786 (MTOR)
   04066 HIF-1 signaling pathway
    100456786 (MTOR)
   04151 PI3K-Akt signaling pathway
    100456786 (MTOR)
   04152 AMPK signaling pathway
    100456786 (MTOR)
   04150 mTOR signaling pathway
    100456786 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100456786 (MTOR)
   04920 Adipocytokine signaling pathway
    100456786 (MTOR)
   04919 Thyroid hormone signaling pathway
    100456786 (MTOR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100456786 (MTOR)
   05230 Central carbon metabolism in cancer
    100456786 (MTOR)
   05231 Choline metabolism in cancer
    100456786 (MTOR)
   05206 MicroRNAs in cancer
    100456786 (MTOR)
   05205 Proteoglycans in cancer
    100456786 (MTOR)
   05214 Glioma
    100456786 (MTOR)
   05221 Acute myeloid leukemia
    100456786 (MTOR)
   05215 Prostate cancer
    100456786 (MTOR)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100456786 (MTOR)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100456786 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 2432 aa AA seqDB search
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TLFYDHHNRTITFLNWFPAQTANERKGGILAIAAVLGHRKNPHREWKVGNATRIGRFANY
LRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVL
VLRELAISVPTFFFQQVQPFFDNIFVAVWDPKTGYPEGARLREEMEEITQQQLVHDKYCK
DLMGFGTKPRHITPFPSFQAVQPQQSNALVGLLGYSSHQGLMGFGVSPSPAKSTLVESRC
CRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVL
SCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHNPALTAVLYDL
SRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLAYSWASRPSLEASDVGSIT
LALRTLGSFEFEGHSLTQFVRHCADHFLNSEHNEIRMEAARTCSRLLTPILSTLISWPCS
CGLCSEPQCKHSSYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGPTH
VVRSPLMQRFLFPGKLPVIPIFLALFVCWIDLLQMVSDFPILTELEHSGNWKNSKSESAR
MLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRK
WVDELFIIIMGHAPGIPLCWPKDQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKT
EQNQGTRREAIRVLGLLGALDPYKHKVLTLGMIDQSRDASAVSLSGXSKSSQDSSDYSTS
EMLVNMGNLPLDEFYPAVSMVALMPDLRDQSLSHHHTMVVQANITFIFKSLGLKCVQFLP
QVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKCLLCHIRPYMDEIVTLMREFWVMNTSI
QSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKVITGWQSSCFGAN
LDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQS
PELRSTAMDTLSSLVFQLGKKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKK
LHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDL
FNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDD
NGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAM
KHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQC
CEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLF
SLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQ
IWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLL
GVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQ
QHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMN
FEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTE
NSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWP
DVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLT
VASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRL
YFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDL
TQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIA
PSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLR
KNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDH
LTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLG
DRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYR
ITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEI
LDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDD
TLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7299 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagc
gtcctgcagcagtttgccagtggcctaaagagccggaatgaggagaccagggccaaagcc
gccaaggagctccagcactatgtcaccatggaactccgagagatgagtcaagaggagtct
actctcttctatgaccaccacaatagaaccatcacatttttgaattggtttccagctcag
accgccaatgagaggaaaggtggcatcttggccatagcagcagtcctgggccacaggaaa
aatcctcatagggagtggaaggtggggaatgccacccgaattggcagatttgccaactat
cttcggaacctccttccctccaatgacccagttgtcatggaaatggcatccaaggccatt
ggccgtcttgccatggcaggggacacttttactgctgagtacgtggaatttgaggtgaag
cgagccctggaatggctgggtgctgaccgcaatgagggccggagacatgcagctgtcctg
gttctccgtgagctggccatcagcgtccctaccttcttcttccagcaagtgcagcccttc
tttgacaacatttttgtggccgtgtgggaccccaaaacaggctaccctgagggagctcgt
ctgagagaagaaatggaagaaatcacacagcagcagctggtacacgacaagtactgcaaa
gatctcatgggcttcggaacaaaacctcgtcacattacccccttccccagtttccaggct
gtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaaggc
ctcatgggatttggggtctcccccagtccagctaagtccaccctggtggagagccggtgt
tgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgcagg
aatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggctgca
ttccgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtccta
agctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctactttcc
gtggctgtgaggtctgaatttaaggtctatttgcctcgcgtgctggacatcatccgagcg
gccctgcccccaaaggacttcgcccataaccctgccctcactgcagtgctctacgacctg
agccgtcagattccacagctaaagaaggacattcaagatggcttactgaaaatgctgtcc
ctggttcttatgcacaaacccctccgccacccaggcatgcccaagggcctggcccatcag
ctggcctactcctgggcctcacgaccctcccttgaggccagcgatgtgggcagcatcact
cttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacccaatttgtt
cgccactgtgcggatcatttcctgaacagtgagcacaatgagatccgcatggaggctgcc
cgcacctgctcccgcctgctcacacccatcctatccacgctcatcagttggccatgctca
tgtggtctatgctcagagccgcagtgcaaacattcaagctattgtgtcttggcgtccctg
gacgagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggct
ctgaatgaccaggtgtttgagatccgggagctggccatctgcactgtggggccgactcac
gtggttcggagtcctctcatgcagcgctttctttttcctggcaagttgccagtgatcccc
attttcttggccctctttgtttgctggattgacctgctgcagatggtgtcagacttccca
attttgacagagttggagcacagtgggaattggaagaactcaaagagcgagagtgcccgc
atgctggggcacctggtctccaatgccccccgactcatccgcccctacatggagcctatt
ctgaaggcattaattttgaaactgaaagatccagaccctgatccaaacccaggtgtgatc
aataatgtcctggcaacaataggagaattggcacaggttagtggcctggaaatgaggaaa
tgggttgatgaactttttattatcatcatgggacatgctccagggattcctctttgttgg
ccaaaagaccaggtggctctgtggaccctgggacagttggtggccagcactggctatgta
gtagagccctacaggaagtaccctactttgcttgaagtgctactgaattttctgaagact
gagcagaaccagggtacacgcagagaggccatccgtgtgttagggcttttaggggctttg
gatccttacaagcacaaagtgttaacattaggcatgatagaccagtcccgggatgcctct
gctgtcagcctgtcaggnnaatccaagtcaagtcaggattcctctgactatagcactagt
gaaatgctggtcaacatgggaaacttgcctctggatgagttctacccagctgtgtccatg
gtggccctgatgccggatcttcgagaccagtcactctctcatcatcacaccatggttgtc
caggccaacatcaccttcatcttcaagtccctgggactcaaatgtgtgcagttcctgccc
caggtcatgcccacgttccttaatgtcattcgagtctgtgatggggccatccgggaattt
ttgttccagcagctgggaatgttggtgtcctttgtgaagtgtctcttatgccacatcaga
ccttatatggatgaaatagtcaccctcatgagagaattctgggtcatgaacacctcaatt
cagagcacgatcattcttctcattgagcaaattgtggtagctcttgggggtgaatttaag
ctctacctgccccagctgatcccacacatgctgcgtgtcttcatgcatgacaacagccca
ggccgcattgtctctatcaaggtgattactggctggcaatccagctgttttggcgccaac
ctggatgactacctgcatttactgctgcctcctattgttaagttgtttgatgcccctgaa
gctccactgccatctcgaaaggcagcgctagagactgtggaccgcctgacggagtccctg
gatttcactgactatgcctcccggatcattcaccctattgttcgaacactggaccagagc
ccagaactgcgctccacagccatggacacgctgtcttcacttgtttttcagctggggaag
aagggatacacacttgctgatgaagaggaggatcctttgatttaccagcatcggatgctt
aggagtggccaaggggatgcattggctagtggacccgtggaaacaggacccatgaaaaaa
ctgcacgtcagcaccatcaacctccaaaaggcctggggcgctgccaggagggtctccaaa
gatgactggctggaatggctgagacgactgagcctggagctgctgaaggactcatcatcg
ccctccctgcgctcctgctgggccctggcacaggcctacaacccgatggccagggatctt
ttcaatgctgcatttgtgtcctgctggtctgaactgaatgaagatcaacaggatgagctc
atcagaagcatcgagttggccctcacctcacaagacatcgctgaagtcacacagaccctc
ttaaacttggctgaattcatggaacacagtgacaagggccccctgccactgagagatgac
aatggcattgttctgctgggtgagagagctgccaagtgccgagcatatgccaaagcacta
cactacaaagaactggagttccagaaaggccccacccctgccattctagaatctctcatc
agcattaataataagctacagcagccggaggcagcggccggagtgttagaatatgccatg
aaacactttggagagctggagatccaggctacctggtatgagaaactgcatgagtgggag
gatgcccttgtggcctatgacaagaaaatggacacgaacaaggatgatccagagctgatg
ctcggccgcatgcgctgcctcgaggccctgggggaatggggtcaactccaccagcagtgc
tgtgaaaagtggaccctggttaatgatgagacccaagccaagatggcccggatggctgct
gcagctgcatggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccct
cgggacacccatgatggggcattttatagagctgtgctggcactgcatcaggacctcttc
tccttggcacaacagtgcattgacaaggccagggacctgctggatgctgaattaactgcg
atggcaggagagagttacagtcgggcatatggggccatggtttcttgccacatgctgtcc
gagctggaggaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccag
atctggtgggagagactgcagggctgccagcgtatcgtagaggactggcagaaaatcctt
atggtgcggtcccttgtggtcagccctcacgaagacatgagaacctggctcaagtatgca
agcctgtgcggcaagagtggcaggctggctcttgctcataaaaccttagtgttgctcctg
ggagttgatccatctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacc
tatgcctacatgaaaaacatgtggaagagtgcccgcaagatcgatgccttccagcacatg
cagcattttgtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccag
cagcataagcaggaactgcacaagctcatggcccgatgcttcttgaaacttggagagtgg
cagctgaatctacagggcatcaatgagagcacaatccccaaagtgctgcagtactacagc
gccgccacagagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaac
ttcgaagctgtgctacattacaaacatcagaaccaagcccgcgacgagaagaagaaactg
cgtcatgccagcggggccaacatcaccaatgccaccactgccgctaccacagccgccact
gccaccaccaccgccagcaccgagggcagcaacagtgagagcgaggccgagagcaccgaa
aacagccccaccccatcaccgctgcagaagaaggtcactgaggatctgtccaaaaccctc
ctgatgtatacggtgcctgctgtccagggcttcttccgttccatctccttgtcacgaggc
aacaacctccaggatacactcagagttctcaccttatggtttgattatggtcactggcca
gatgtcaacgaggccttagtggagggggtgaaagccatccagattgatacctggctacag
gttatacctcagctcattgcaagaattgatacgcccagacccttggtgggacgtctcatt
caccagcttctcacagacattggtcggtaccacccccaggccctcatctaccccctgaca
gtggcttctaagtctaccacgacagcccggcacaatgcagccaacaagattctgaagaac
atgtgtgagcacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatc
cgagtggccatcctctggcatgagatgtggcacgaaggcctggaggaggcgtctcgtttg
tactttggggaaaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatg
atggaacggggtccccagactctgaaggaaacatcctttaatcaggcctatggtcgagat
ttaatggaggcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctc
acccaagcctgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcag
ctcacatccttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaa
ttggctgtgccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagca
ccgtctttgcaagtcatcacatctaagcagaggccccggaaattgacacttatgggcagc
aacgggcatgagtttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgt
gtgatgcagctcttcggcctggttaatacccttctggccaatgacccaacatctcttcgg
aaaaatctcagcatccagagatatgctgtcatccctttatcgaccaactcgggcctcatt
ggctgggtcccccactgtgacacactgcacgccctcatccgggactacagggagaagaag
aagatccttctcaacatagagcatcgcatcatgttgcggatggctccggactatgaccac
ttaactctgatgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggac
gacctggccaagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaaga
accaattatacccgttctttagcggtcatgtcaatggttgggtatattttaggcctggga
gatagacacccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgac
tttggggactgctttgaggttgctatgacccgagagaagtttccagagaagattccattt
agactaacaagaatgttgaccaatgctatggaggttacaggcctggatggcaactacaga
atcacatgccacacagtgatggaggtgctgcgagagcacaaggacagtgtcatggccgtg
ctggaagcctttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaa
ggcaacaagcgatccagaacgaggacggattcctactctgctggccagtcagtcgaaatt
ttggacggtgtggaacttggagagccagcccataagaaaacggggaccacagtgccagaa
tctattcattctttcattggagatggtttggtgaaaccagaggccctaaataagaaagct
atccagattattaacagggttcgagataagctcactggtcgggacttctctcatgatgac
actttggatgttccaacgcaagttgagctgctcatcaaacaagcgacatcccatgaaaac
ctctgccagtgctatattggctggtgccctttctggtaa

DBGET integrated database retrieval system