KEGG   Pongo abelii (Sumatran orangutan): 100457486Help
Entry
100457486         CDS       T01416                                 

Gene name
KAT7
Definition
K(lysine) acetyltransferase 7
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100457486 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 605 aa AA seqDB search
MQAVVSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVRNLQSFG
TEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPP
RTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCP
TPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQDDNNRH
ATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYD
LDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLY
MCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAK
LFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGY
GKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQ
ETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWT
PPKGT
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagtagtatcagatggaaccgaagattccgatttttctacagatctcgagcac
acagacagttcagaaagtgatggcacatcccggcgatctgctcgagtcacccgttcctca
gccaggctaagccagagttctcaagattccagtcctgttcgaaatttgcagtcttttggc
actgaggagcctgcttactctaccagaagagtgacccgtagtcagcagcagcctacccca
gtgacaccgaaaaagtaccctcttcggcagactcgttcatctggctcagaaactgagcaa
gtggttgatttttcagatagagaaactaaaaatacagctgatcatgatgagtcaccgcct
cgaactccaactggaaacgcaccttcttctgagtctgacatagacatctccagccccaat
gtgtctcacgatgagagcattgccaaggacatgtccctgaaggactcaggcagtgatctc
tctcatcgccccaagcgccgtcgcttccatgaaagctacaacttcaatatgaagtgtcct
acaccaggctgtaactctctaggacaccttacaggaaaacatgagagacatttctccatc
tcaggatgcccactgtatcataacctctcagctgacgaatgcaaggtgagagcacagagc
cgggataagcagatagaagaaaggatgctgtctcacaggcaagatgacaacaacaggcat
gcaaccaggcaccaggcaccaacggagaggcagcttcgatataaggaaaaagtggctgaa
ctcaggaagaaaagaaattctggactgagcaaagaacagaaagagaaatatatggaacac
agacagacctatgggaacacacgggaacctcttttagaaaacctgacaagcgagtatgac
ttggatcttttccgaagagcacaagcccgggcttcagaggatttggagaagttaaggctg
caaggccaaatcacagagggaagcaacatgattaaaacaattgcttttggccgctatgag
cttgatacctggtaccattctccatatcctgaagaatatgcacggctgggacgtctctat
atgtgtgaattctgtttaaaatatatgaagagccaaacgatactccgccggcacatggcc
aaatgtgtgtggaaacacccacctggtgatgagatatatcgcaaaggttcaatctctgtg
tttgaagtggatggcaagaaaaacaagatctactgccaaaacctgtgcctgttggccaaa
ctttttctggaccacaagacattatattatgatgtggagcccttcctgttctatgttatg
acagaggcggacaacactggctgtcacctgattggatatttttccaaggaaaagaattca
ttcctcaactacaacgtatcctgtatccttactatgcctcagtacatgagacagggctat
ggcaagatgcttattgatttcagttatttgctttccaaagtcgaagaaaaagttggctcc
ccagaacgtccactctcagatctggggcttataagctatcgcagttattggaaagaagta
cttctccgctacctgcataatttccaaggcaaagagatttctatcaaagaaatcagtcag
gagacagctgtgaatcctgtggacattgtcagcactctgcaagcccttcagatgctcaag
tactggaagggaaaacacctagttttaaagagacaggacctgattgatgagtggatagcc
aaagaggccaaaaggtccaactccaataaaaccatggatcccagctgcttaaaatggacc
cctcccaagggcacttaa

DBGET integrated database retrieval system