KEGG   Pongo abelii (Sumatran orangutan): 100457524Help
Entry
100457524         CDS       T01416                                 

Gene name
TESK2
Definition
(RefSeq) dual specificity testis-specific protein kinase 2 isoform X1
  KO
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100457524 (TESK2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   100457524 (TESK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 563 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEEFEGGGGGDGNVSQVGRVWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSLGSEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRR
TIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLKGGKIKFFDLPS
KSVISLVFDLDAPGPGTMPLADWQEPLAPPIRRWRSLPSSPEFLHQEACPFVGREESLSD
GPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSSLQEENGFGSRPQGTSPCPAGASE
EMEVEERPAGSTPATFSTSGIGL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggatttcctccacgtgtggagcgtcttgaa
gagtttgaaggaggtggtggaggagacggaaatgtgagccaggtgggaagagtctggcca
tcttcgtatcgagcccttataagtgccttttccagactgacacgtttggatgatttcacc
tgtgaaaaaataggatctggcttcttttctgaagtgttcaaggtacgacaccgagcttct
ggtcaggtgatggctcttaagatgaacacgttgagcagtaaccgggcaaacatgctgaaa
gaagtacagctcatgaatagactctcccatcccaacatccttaggttcatgggtgtgtgt
gttcatcaaggacaattgcatgcacttacagagtatatcaactccgggaacctggaacag
ttgctagacagtaacctgcatttgccttggactgtgagggtaaaactggcctatgacata
gcagtgggcctcagctaccttcacttcaaaggcatttttcatcgggacctcacatctaag
aactgcctgataaagagggatgagaatggttactctgcagtggtagctgactttggcctg
gctgagaagatccccgatgtcagcctggggagtgagaagctggccgtggtgggttcccca
ttctggatggcacctgaggttctccgagatgagccctataatgaaaaggcagatgtgttc
tcttatggtatcatcctctgcgagatcatcgctcgcatccaggccgatccggactatctt
ccccgcacagagaatttcgggctagactatgatgctttccagcacatggtgggagactgt
cccccagactttctgcagcttaccttcaactgctgtaatatggaccccaaactgcgccca
tcttttgtggagattgggaagaccctggaggaaattctgagccgcctacaggaagaagag
caggagagggataggaagctgcagcccacagccaggggactcttggagaaagcacctggg
gtgaagcgactaagctcactggatgacaagatcccccacaagtcaccatgcccaagacgt
actatctggctgtctcgaagccagtcagatatcttttcccgtaagcccccacgtacagtg
agtgtcttggacccatactaccggccacgagatggtgctgcccgcacccccaaagtcaac
ccttttagtgctcgccaggacctcaaggggggcaagatcaagttttttgacctgcccagc
aagtctgtcatctctctggtatttgacctggatgcaccggggcccggaactatgcccctg
gctgactggcaggagcccctggccccacctattcgccggtggcgttccttgcctagttcg
cctgagttcttgcatcaagaggcttgtccatttgtgggccgggaagaatcgctatctgat
gggcccccaccacgcctaagtagtctcaagtacagagttaaagagatcccaccattccgg
gcatctgccctaccagctgctcaagcccatgaggctatggactgctccagtctccaggaa
gaaaatggttttgggtccaggccccaggggaccagtccatgccctgcgggtgcttctgag
gagatggaggtagaagaaaggccagcaggctcaactccagccactttctccacctcaggc
ataggcctgtaa

DBGET integrated database retrieval system