KEGG   Pongo abelii (Sumatran orangutan): 100457719Help
Entry
100457719         CDS       T01416                                 

Gene name
PAX5
Definition
paired box 5
Orthology
K09383  
paired box protein 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100457719 (PAX5)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    100457719 (PAX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 391 aa AA seqDB search
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLA
ERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYS
ISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRV
FERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
IVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGTPYSHPQYSSYNDSWRF
PNPGLLGSPYYYSAAARGAAPPAAATAYDRH
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatttagagaaaaattatccgactcctcggaccagcaggacaggacatggaggagtg
aatcagcttgggggggtttttgtgaatggacggccactcccggatgtagtccgccagagg
atagtggaacttgctcatcaaggtgtcaggccctgcgacatctccaggcagcttcgggtc
agccatggttgtgtcagcaaaattcttggcaggtattatgagacaggaagcatcaagcct
ggggtaattggaggatccaaaccaaaggtcgccacacccaaagtggtggaaaaaatcgct
gagtataaacgccaaaatcccaccatgtttgcctgggagatcagggaccggctgctggca
gagcgggtgtgtgacaatgacaccgtgcctagcgtcagttccatcaacaggatcatccgg
acaaaagtacagcagccacccaaccaaccagtcccagcttccagtcacagcatagtgtcc
actggctccgtgacgcaggtgtcctcggtgagcacggattcggccggctcgtcgtactcc
atcagcggcatcctgggcatcacgtcgcccagcgccgacaccaacaagcgcaagagagac
gaaggtattcaggagtctccggtgccgaacggccactcacttccgggcagagatttcctc
cggaagcagatgcggggagacttgttcacacagcagcagctggaggtgctggaccgcgtg
tttgagaggcagcactactcagacatcttcaccaccacagagcccatcaagcccgagcag
accacagagtattcagccatggcctcgctggctggtgggctggacgacatgaaggccaat
ctggccagccccacccctgctgacatcgggagcagtgtgccaggcccgcagtcctacccc
attgtgacaggccgtgacttggcgagcacgaccctccccgggtaccctccacacgttccc
cccgctggacagggcagctactcagcgccgacgctgacagggatggtgcctgggagtgag
ttttccgggactccctacagccaccctcagtattcctcgtacaacgactcctggaggttc
cctaacccggggctgcttggctccccctactattatagcgctgctgcccgaggagccgcc
ccacctgcagctgccactgcctatgaccgtcactga

DBGET integrated database retrieval system