KEGG   Pongo abelii (Sumatran orangutan): 100457779Help
Entry
100457779         CDS       T01416                                 

Definition
cytochrome P450 2B6-like
Orthology
K17709  
cytochrome P450, family 2, subfamily B, polypeptide 6 [EC:1.14.13.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arachidonic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pon00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:pon00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:pon00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:pon00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 491 aa AA seqDB search
MELSVLLFLALLTGLLLLLVQRHPNTHGRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVVLCGVQAIREALVDKAEAFSGRGKIAIMDPVYQGYGVIFANGNR
WKVLRRFSVTTMRDFGMGKQSVEERIQEEAQCLIEELQKSKGALMDPTFLFHSITANIIC
SIVFGKRFHYQDQEFLKMLNLFCQSFSLISSISSQLFELFSGFLKYFPGAHRQLYKNLQE
INAYIGHSVEKHRETLDPSAPQDLIDTYLLHMEKEKSNPHSEFSHQNLIINTLSLFFAGT
ETTSTTLCYGFLLMLKYPHVAERVYKEIEQVVGPHCPPVLDDRAKMPYTEAVIHEIQRFA
DLLPMGVPHIVTQHTRFRGYIIPKDTEVFLILSTALRDPHYFEKPDAFNPDHFLDANGAL
KKNEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSVASPVAPEDIDLTPQECGVGKI
PPTYQIRFLPH
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcgtcctcctcttccttgcactcctcacaggcctcttgctactcctggtt
cagcgccaccctaacacccatggccgcctcccaccagggccccgccctctgccccttttg
gggaaccttctgcagatggacagaagaggcctactcaaatcctttctgaggttccgagag
aaatatggggacgtcttcacggtacacctgggaccgaggcccgtggtcgtgctgtgtgga
gtacaggccatacgggaggccctggtggacaaggctgaggccttctctggccggggaaaa
atcgccatcatggacccagtctaccagggatatggtgtgatctttgccaatggaaaccgc
tggaaggtgcttcggcgattctctgtgaccaccatgagggacttcgggatgggaaagcag
agtgtggaggagcggattcaggaggaggctcagtgtctgatagaggagcttcagaaatcc
aagggagccctcatggaccctaccttcctcttccattccattaccgccaacatcatctgc
tccatcgtctttggaaaacgcttccactaccaagatcaagagttcctgaagatgctgaac
ttgttctgccagagtttctcactcatcagctctatatccagccagctgtttgagctcttc
tctggcttcttgaaatactttcctggggcacacaggcaactctacaaaaacctgcaggaa
atcaatgcttacattggccacagtgtggagaagcaccgtgaaaccctggaccccagcgcc
ccccaggacctcattgacacctacctgctccacatggaaaaagagaaatccaacccacac
agtgaattcagccaccagaacctcatcatcaacacgctctcactcttctttgctggcact
gagaccaccagcaccactctctgctacggcttcctgctcatgctcaaataccctcatgtc
gcagagagagtctacaaggagattgaacaggtggttggcccacattgccctccagtgctt
gatgaccgagccaaaatgccatacacagaggcagtcatccatgagattcagagatttgcc
gaccttctccccatgggtgtgccccacattgtcacccaacacaccaggttccgagggtac
atcatccccaaggacacggaagtatttctcatcctgagcactgctctccgtgacccacac
tactttgaaaaaccagacgccttcaatcctgaccactttctggatgccaatggggcactg
aaaaagaatgaagcttttatccccttctccttagggaagcgcatttgtcttggtgaaggc
attgcccgtgccgaattattcctcttcttcaccaccatcctccagaacttctccgtggcc
agccccgtggctcctgaagacatcgatctgacaccccaggagtgtggcgtgggcaaaata
cccccaacataccagatccgcttcctgccccactga

DBGET integrated database retrieval system