KEGG   Pongo abelii (Sumatran orangutan): 100457976Help
Entry
100457976         CDS       T01416                                 

Gene name
APOA4
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100457976 (APOA4)
   04977 Vitamin digestion and absorption
    100457976 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 416 aa AA seqDB search
MFLKAVVLALALVAVTGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIRKELEEVRARLLPHANEV
SQKIGDNVRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLHASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDAQEKLNHQLEG
LAFQMKKNAEELKTRISASAEELRQRLAPLVEDVRGNLRGNTEGLQKSLAELGGHLDRQV
EEFRSRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQQQEQQQEQQQEQQQEQQQGQVQMLAPLES
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctggccctggccctggtggctgtcaccggagccagggct
gaggtcagtgctgaccaggtggccacggtgatgtgggactacttcagccagctgagcaac
aatgccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgcc
ctcttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctg
gtgcccttcgccaccgagctgcatgaacgcctggctaaggactcggagaaactgaaggag
gagattcggaaggagctggaggaggtgagggcccggctgctgccccatgcgaatgaggtg
agccagaagatcggggacaatgtgcgagagctgcagcagcgcctggagccctacgcggac
cagctgcgcacccaggtcaacacacaggctgagcagctgcggcgccagctgaccccctac
gcgcagcgcatggagagagtgctgcgggagaacgcagacagcctgcacgcctcgctgagg
ccccacgccgacgagctcaaggccaagatcgaccagaacgtggaggagctcaagggacgc
cttacgccctacgccgacgaattcaaagtcaagattgaccagaccgtggaggagctgcgc
cgcagcctggctccctatgctcaggacgcgcaggagaagctcaaccaccagctcgagggc
ctggccttccagatgaagaagaacgccgaggagctcaagaccaggatctcggccagtgcc
gaggagctgcggcagaggctggcgcccttggtggaggacgtgcgtggcaacctgaggggc
aacaccgaggggctgcagaagtcactggcagagctgggtgggcacctggaccggcaggtg
gaggagttccgaagccgggtggagccctacggggaaaactttaacaaagccctggtgcag
cagatggaacagctcaggcagaagctgggcccccatgcgggggacgtggaaggccacttg
agcttcctggagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggag
aaagagagccaggacaagaccctctccctcccggagctggagcagcagcaggaacagcag
caggagcagcagcaggagcagcagcaggaacagcagcaggagcagcagcaggagcagcag
caggaacagcagcaggggcaggtgcagatgctggcccctttggagagctaa

DBGET integrated database retrieval system