KEGG   Pongo abelii (Sumatran orangutan): 100457976Help
Entry
100457976         CDS       T01416                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  
apolipoprotein A-IV
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    100457976 (APOA4)
   04979 Cholesterol metabolism
    100457976 (APOA4)
   04977 Vitamin digestion and absorption
    100457976 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
11
AA seq 416 aa AA seqDB search
MFLKAVVLALALVAVTGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIRKELEEVRARLLPHANEV
SQKIGDNVRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLHASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDAQEKLNHQLEG
LAFQMKKNAEELKTRISASAEELRQRLAPLVEDVRGNLRGNTEGLQKSLAELGGHLDRQV
EEFRSRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQQQEQQQEQQQEQQQEQQQGQVQMLAPLES
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctggccctggccctggtggctgtcaccggagccagggct
gaggtcagtgctgaccaggtggccacggtgatgtgggactacttcagccagctgagcaac
aatgccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgcc
ctcttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctg
gtgcccttcgccaccgagctgcatgaacgcctggctaaggactcggagaaactgaaggag
gagattcggaaggagctggaggaggtgagggcccggctgctgccccatgcgaatgaggtg
agccagaagatcggggacaatgtgcgagagctgcagcagcgcctggagccctacgcggac
cagctgcgcacccaggtcaacacacaggctgagcagctgcggcgccagctgaccccctac
gcgcagcgcatggagagagtgctgcgggagaacgcagacagcctgcacgcctcgctgagg
ccccacgccgacgagctcaaggccaagatcgaccagaacgtggaggagctcaagggacgc
cttacgccctacgccgacgaattcaaagtcaagattgaccagaccgtggaggagctgcgc
cgcagcctggctccctatgctcaggacgcgcaggagaagctcaaccaccagctcgagggc
ctggccttccagatgaagaagaacgccgaggagctcaagaccaggatctcggccagtgcc
gaggagctgcggcagaggctggcgcccttggtggaggacgtgcgtggcaacctgaggggc
aacaccgaggggctgcagaagtcactggcagagctgggtgggcacctggaccggcaggtg
gaggagttccgaagccgggtggagccctacggggaaaactttaacaaagccctggtgcag
cagatggaacagctcaggcagaagctgggcccccatgcgggggacgtggaaggccacttg
agcttcctggagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggag
aaagagagccaggacaagaccctctccctcccggagctggagcagcagcaggaacagcag
caggagcagcagcaggagcagcagcaggaacagcagcaggagcagcagcaggagcagcag
caggaacagcagcaggggcaggtgcagatgctggcccctttggagagctaa

DBGET integrated database retrieval system