KEGG   Pongo abelii (Sumatran orangutan): 100458142Help
Entry
100458142         CDS       T01416                                 

Definition
cytochrome P450 2B6-like
Orthology
K17709  
cytochrome P450, family 2, subfamily B, polypeptide 6 [EC:1.14.13.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arachidonic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100458142
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100458142
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100458142
   00982 Drug metabolism - cytochrome P450
    100458142
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     100458142
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP2 family
   100458142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 491 aa AA seqDB search
MELSVLLFLALLTGLLLLLVQGHPNTHGRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPVFRGYGVIFANGNR
WKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIQELRKSKGALMDPTFLFQSITANIIC
SIVFGKRFHYQDQEFLKILNLFYQTFSLVSSVFGQLFELFSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSTPKDLIDTYLLHMEKEKSNAHSEFSHQNLTLNTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIHEIQRFA
DLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALRDPHYFEKPDAFNPDHFLDASGAL
KKNEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSVASPVAPEDIDLTPQECGVGKI
PPTYQIRFLPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcgtcctcctcttccttgcactcctcacaggcctcttgctactcctggtt
cagggccaccctaacacccatggccgcctcccaccaggtccccgccctctgccccttttg
gggaaccttctgcagatggacagaagaggcctactcaaatcctttctgaggttccgagag
aaatatggggacgtcttcacggtacacctgggaccgaggcccgtggtcatgctgtgtgga
gtagaggccatacgggaggccctggtggacaaggctgaggccttctctggccggggaaaa
atcgccatggtcgacccagtcttccggggatatggtgtgatctttgccaatggaaaccgc
tggaaggtgcttcggcgattctctgtgaccaccatgagggacttcgggatgggaaagcgg
agtgtggaggagcggattcaggaggaggctcagtgtctgatacaggagcttcggaaatcc
aagggagccctcatggaccctaccttcctcttccagtccattaccgccaacatcatctgc
tccatcgtcttcggaaaacgattccactaccaagatcaagagttcctgaagatactgaac
ttgttctaccagactttttcactcgtcagctctgtattcggccagctgtttgagctcttc
tctggcttcttgaaatactttcctggggcacacaggcaagtttacaaaaaccttcaggaa
atcaatgcttacattggccacagtgtggagaagcaccgtgaaaccctggaccccagcacc
cccaaggacctcatcgacacctacctgctccacatggaaaaagagaaatccaacgcacac
agtgaattcagccaccagaacctcaccctcaacacgctctcgctcttctttgctggcact
gagaccaccagcaccactctccgctacggcttcctgctcatgctcaaataccctcatgtc
gcagagagagtctacagggagattgaacaggtgattggaccacatcgccctccagagctt
catgaccgagccaaaatgccatacacagaggcagtcatccatgagattcagagatttgcc
gaccttctccccatgggtgtgccccacattgtcacccaacacaccagcttccgagggtac
atcatccccaaggacacggaagtatttctcatcctgagcactgctctccgtgacccacac
tactttgaaaaaccagacgccttcaatcctgaccactttctggatgccagtggggcactg
aaaaagaatgaagcctttatccccttctccttagggaagcggatttgtcttggtgaaggc
atcgcccgcgctgaattgttcctcttcttcaccaccatcctccagaacttctccgtggcc
agccccgtggctcctgaagacatcgacctgacaccccaggagtgtggtgtgggcaaaata
cccccaacgtaccagatccgcttcctgccccgctga

DBGET integrated database retrieval system