KEGG   Pongo abelii (Sumatran orangutan): 100458183Help
Entry
100458183         CDS       T01416                                 

Gene name
GNB2
Definition
(RefSeq) guanine nucleotide binding protein (G protein), beta polypeptide 2
  KO
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100458183 (GNB2)
   04151 PI3K-Akt signaling pathway
    100458183 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    100458183 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    100458183 (GNB2)
   04727 GABAergic synapse
    100458183 (GNB2)
   04725 Cholinergic synapse
    100458183 (GNB2)
   04728 Dopaminergic synapse
    100458183 (GNB2)
   04726 Serotonergic synapse
    100458183 (GNB2)
   04723 Retrograde endocannabinoid signaling
    100458183 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    100458183 (GNB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100458183 (GNB2)
  Substance dependence
   05032 Morphine addiction
    100458183 (GNB2)
   05034 Alcoholism
    100458183 (GNB2)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100458183 (GNB2)
GTP-binding proteins [BR:pon04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    100458183 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 338 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQPGQQRDPTFSHPMGRGCVLFSCHPSALP
TPFPTRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICS
IYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAG
HSGDVMSLSLAPDGRTFVSGACDASIKLEDVRDSMCRQTFIGHESDINAVAFFPNGYAFT
TGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKG
DRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggccgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggactcaacactgacccagcctggacaacagagagaccctacc
ttctcccaccctatgggaagggggtgtgtcttgttttcatgtcacccttctgctctccct
acaccgttccccaccaggctgctggtcagcgcctcccaggatgggaagctcatcatctgg
gacagctacaccaccaacaaggttcacgccatcccgctgcgctcctcttgggtcatgacc
tgtgcctacgcgccctcagggaactttgtggcctgtggggggttggacaacatctgctcc
atctacagcctcaagacccgcgagggcaacgtcagggtcagccgggagctgcctggccac
actgggtacctgtcgtgttgccgcttcctggatgacaaccaaatcatcaccagctctggg
gataccacctgtgccctgtgggacattgagacaggccagcagacagtgggttttgctgga
cacagtggggatgtgatgtccctgtccctggcccccgatggccgcacgtttgtgtcaggc
gcctgtgatgcctctatcaagctggaggatgtgcgggattccatgtgccgacagaccttc
atcggccacgaatccgacatcaatgcagtggctttcttccccaacggctacgccttcacc
accggctctgacgacgccacgtgccgcctcttcgacctgcgggccgatcaggagctcctc
atgtactcgcatgacaacatcatctgtggcatcacctctgttgccttctcgcgcagcggc
cggctgctgctcgctggctatgacgacttcaactgcaacatctgggatgccatgaagggc
gaccgtgcaggggtcctcgctggccacgacaaccgcgtgagctgcctcggggtcaccgac
gatggcatggctgtggccacgggctcctgggactccttcctcaagatctggaactaa

DBGET integrated database retrieval system