KEGG   Pongo abelii (Sumatran orangutan): 100458223Help
Entry
100458223         CDS       T01416                                 

Gene name
PPP1CC
Definition
(RefSeq) serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03015  mRNA surveillance pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04390  Hippo signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon04720  Long-term potentiation
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04921  Oxytocin signaling pathway
pon04931  Insulin resistance
pon05031  Amphetamine addiction
pon05034  Alcoholism
pon05168  Herpes simplex infection
pon05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100458223 (PPP1CC)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100458223 (PPP1CC)
   04024 cAMP signaling pathway
    100458223 (PPP1CC)
   04022 cGMP - PKG signaling pathway
    100458223 (PPP1CC)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100458223 (PPP1CC)
   04218 Cellular senescence
    100458223 (PPP1CC)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100458223 (PPP1CC)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100458223 (PPP1CC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100458223 (PPP1CC)
  Endocrine system
   04910 Insulin signaling pathway
    100458223 (PPP1CC)
   04921 Oxytocin signaling pathway
    100458223 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100458223 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100458223 (PPP1CC)
  Nervous system
   04728 Dopaminergic synapse
    100458223 (PPP1CC)
   04720 Long-term potentiation
    100458223 (PPP1CC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100458223 (PPP1CC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100458223 (PPP1CC)
  Substance dependence
   05031 Amphetamine addiction
    100458223 (PPP1CC)
   05034 Alcoholism
    100458223 (PPP1CC)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100458223 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    100458223 (PPP1CC)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100458223 (PPP1CC)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100458223 (PPP1CC)
Transcription machinery [BR:pon03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100458223 (PPP1CC)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100458223 (PPP1CC)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100458223 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 100458223
NCBI-ProteinID: XP_002823789
Ensembl: ENSPPYG00000004955
UniProt: H2NIN2
Position
12
AA seq 337 aa AA seqDB search
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttagataaactcaacatcgacagcattatccaacggctgctggaagtgaga
gggtccaagcctggtaagaatgtccagcttcaggagaatgaaatcagaggactgtgctta
aagtctcgtgaaatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttgctgcgactttttgagtacggtggt
ttcccaccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagactatctgcctcttactggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggatgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacgcctccaagggttgcatcaggcctgaac
ccgtccattcagaaagcttcaaattatagaaacaatactgttctatacgagtga

DBGET integrated database retrieval system