KEGG   Pongo abelii (Sumatran orangutan): 100458256Help
Entry
100458256         CDS       T01416                                 

Gene name
HDAC5
Definition
histone deacetylase 5
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100458256 (HDAC5)
  Substance dependence
   05034 Alcoholism
    100458256 (HDAC5)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100458256 (HDAC5)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100458256 (HDAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 1107 aa AA seqDB search
MSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELRGALVGSVDP
TLREQQLQQELLALKHXQQLQKQLLFAEFQKQHDHLXRQHEVQLQKHLRXARGQQEMLAA
KRQQELEQQRQREQQRQEELENLRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKS
KEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLPGPYDSRDDFPLR
KTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEITGAGPGASSVCNSAP
GSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLG
LQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGD
GSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSR
TQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGELPRQPTTHPEETEEE
LTEQQEALLGEGALTMPREGSTESESTQEDLEEEDEEEDGEEEEDCIQVKDEEGESGAEE
GPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQSSPAAPGGMKSPPDQ
PVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQETGLLSKCERIRGRKA
TLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLPCGGIGVDSDTVWNEM
HSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLL
QQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGSGAPEEVGGGPG
VGYNVNVAWIGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFDAVEGHLSPLGG
YSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVSALLSVELQPLDEAVL
QQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGETEEAETVSAMALLSVG
AEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggccgggaaccatccttggaaatcctgccgcggacttctctgcacagcatccct
gtgacagtggaggtgaagccggtgctgccaagagccatgcccagttccatggggggtggg
ggtggaggcagccccagccccgtggagctacggggggctctggtgggctctgtggacccc
acactgcgggagcagcaactgcagcaggagctcctggcgctcaagcacncgcagcagctg
cagaagcagctcctgttcgctgagttccagaaacagcatgaccacctgnacaggcagcat
gaagtccagctgcagaagcacctcaggtgagcgagggggcagcaggagatgctggcagcc
aagcggcagcaggagctggagcagcagcggcagcgggagcagcagcggcaggaagagctg
gagaacctgcggctggagcagcagctgctcatcctgcggaacaaggagaagagcaaagag
agtgccattgccagtaccgaggtaaagctgaggctccaggaattcctcttgtcgaagtca
aaggagcccacaccaggcggcctcaaccattccctcccacagcaccccaaatgctgggga
gcccaccatgcttctttggaccagagttcccctccccagagcggcccccctgggacgcct
ccctcctacaaactgcctttgcctgggccctacgacagtcgagacgacttccccctccgc
aaaacagcctctgaacccaacttgaaagtgcgttcaaggctaaaacagaaggtggccgag
cggagaagcagtcccctcctgcgtcgcaaggatgggactgttattagcacctttaagaag
agagctgttgagatcacaggtgccgggcctggggcgtcgtccgtgtgtaacagcgcaccc
ggctccggccccagctctcctaacagctcccacagcaccatcgctgagaatggctttact
ggctcagtccccaacatccccaccgagatgctccctcagcaccgagccctccctctggac
agctcccccaaccagttcagcctctacacgtctccttctctgcccaacatctccctaggg
ctgcaggccacggtgactgtcaccaactcacacctcactgcctccccgaagctgtcgaca
cagcaggaggccgagaggcaggccctccagtccctgcggcagggtggcacgctgaccggc
aagttcatgagcacatcctctatccctggctgcctgctgggcgtggcactggagggcgac
gggagcccccacgggcatgcctccctgctgcagcatgtgctgttgctggagcaggcccgg
cagcagagcaccctcattgctgtgccactccacgggcagtccccactagtgacgggtgaa
cgtgtggccaccagcatgcggacggtaggcaagctcccgcggcatcggcccctgagccgc
actcagtcctcaccgctgccgcagagtccccaggccctgcagcagctggtcatgcaacaa
cagcaccagcagttcctggagaagcagaagcagcagcagctacagctgggcaagatcctc
accaagactggggagctgcccaggcagcccaccacccaccctgaggagacagaggaggag
ctgacggagcagcaggaggccttgctgggggagggagccctgaccatgccccgggagggc
tccacagagagtgagagcacacaggaagacctggaggaggaggatgaggaagaggatggg
gaggaagaggaggattgcatccaggtcaaggacgaagagggcgagagtggtgctgaggag
gggcctgacttggaggagcctggtgctggttacaaaaaactgttctcagatgcccagccg
ctgcagcctctgcaggtgtaccaggcgcccctcagcctggccactgtgccccaccaggcc
ctgggccgcacccagtcctcccctgctgcccctgggggcatgaagagccccccagaccag
cccgtcaagcacctcttcaccacaggtgtggtctacgacacgttcatgctaaagcaccag
tgcatgtgcgggaacacacacgtgcaccctgagcatgctggccggatccagagcatctgg
tcccggctgcaggagacaggcctgcttagcaagtgcgagcggatccgaggtcgcaaagcc
acgctagatgagatccagacagtgcactctgaataccacaccctgctctatgggaccagc
cccctcaaccggcagaagctagacagcaagaagttgctcggccccatcagccagaagatg
tatgctgtgctgccttgtgggggcatcggggtggacagtgacaccgtgtggaatgagatg
cactcctccagtgctgtgcgcatggcagtgggctgcctgctggagctggccttcaaggtg
gctgcaggagagctcaagaatggatttgccatcatccggcccccaggacaccacgccgag
gaatccacagccatgggattctgcttcttcaactctgtagccatcactgcaaaactccta
cagcagaagttgaacgtgggcaaggtcctcatcgtggactgggacattcaccatggcaat
ggcacccagcaggcgttctacaacgacccctctgtgctctacatctctctgcatcgctat
gacaacgggaacttctttccaggctctggggctcctgaagaggttggtggagggccaggc
gtggggtacaatgtgaacgtggcatggataggaggtgtggacccccccattggagacgtg
gagtaccttacagccttcaggacagtggtgatgcccattgcccacgagttctcacctgac
gtggtcctagtctctgccgggtttgatgctgttgaaggacatctgtctcctctgggtggc
tactctgtcaccgccagatgttttggccacttgaccaggcagctgatgaccctggcaggg
ggccgggtggtgctggccctggagggaggccatgacttgaccgccatctgtgatgcctct
gaggcttgtgtctcggctctgctgagtgtagagctgcagcccttggacgaggcagtcttg
cagcaaaagcccaacatcaacgcagtggccacgctagagaaagtcatcgagatccagagc
aaacactggagctgtgtgcagaagtttgccgctggtctgggccgttccctgcgagaggcc
caagcaggtgagaccgaggaggccgagactgtgagcgccatggccttgctgtcggtgggg
gccgagcaggcccaggctgcagcagcccgggagcacagccccaggccggcagaggagccc
atggagcaggagcctgccctgtga

DBGET integrated database retrieval system