KEGG   Pongo abelii (Sumatran orangutan): 100458271Help
Entry
100458271         CDS       T01416                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 13-like
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100458271
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100458271
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100458271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 275 aa AA seqDB search
NSEGGLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKI
FLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRK
QDPDTWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFF
DSSGGNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDML
HMHGTENGLQDNDIKPRVSEWEVIQESGTKLKPMY
NT seq 826 nt NT seq  +upstreamnt  +downstreamnt
aattctgaaggtggactctatgtatgcatgaatacatttttggcctttggaagggaacat
gttgaaagacattttcgaaaaactggacagagtgtatacatgcacctgaaaagacatgtg
cgagagaaggtaagaggggcgtctggtggagcgttaccaaaaaggaggaattccaagatt
tttttagatctagatactgatgatgatttaaatagcgacgattatgaatatgaagatgaa
gccaaacttgttatattcccagatcactatgaaatagcactaccaaatattgaggagtta
ccagccctggtaacaattgcttgtgatgcagttctcagctcaaaatctccatacagaaag
caggacccagacacgtgggaaaatgaattgccagtatctaaatatgccaacaacctcacc
cagctggacaatggagtcaggattcctccaagtggttggaagtgtgccagatgcgacctg
cgagaaaacctctggttgaatctgactgacggctctgtcctgtgtggaaagtggttcttt
gacagctctggtggcaacgggcatgcgctggagcattacagagacatgggctacccgcta
gccgtgaaactgggaaccatcactcctgatggggcagatgtttattcttttcaagaagaa
gaacctgttttggatcctcatttggccaagcacttagcgcattttggaattgatatgctt
catatgcatgggacagagaatgggctccaggacaatgacatcaagccgagggtcagtgag
tgggaagtgatccaggagtcgggcacgaagctgaagccaatgtatg

DBGET integrated database retrieval system