KEGG   Pongo abelii (Sumatran orangutan): 100458378Help
Entry
100458378         CDS       T01416                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Legionellosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    100458378 (CLK1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100458378 (CLK1)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100458378 (CLK1)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100458378 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2B
AA seq 434 aa AA seqDB search
MCDSHYLESRSINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGR
SSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEG
AFGKVVECIDHKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEW
FEHHGHICIVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLK
PENILFVQSDYTEAYNPKIKRDERTLVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEV
ILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRK
YFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLKE
ALKHPFFDLLKKSI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatagccattatttggaaagcaggtctataaatgagaaagattatcatagtcga
cgctacattgatgagtacagaaatgactacactcaaggatgtgaacctggacatcgccaa
agagaccatgaaagccggtatcagaaccatagtagcaagtcttctggtagaagtggaaga
agtagttataaaagcaaacacaggattcaccacagtacttcacatcgtcgttcacatggg
aagagtcaccgaaggaaaagaaccaggagtgtagaggatgatgaggagggtcacctgatc
tgtcagagtggagacgtactaagtgcaagatatgaaattgttgatactttaggtgaagga
gcttttggaaaagtggtggagtgcatcgatcataaagcgggaggtagacatgtagcagta
aaaatagttaaaaatgtggatagatactgtgaagctgctcgctcagaaatacaagttctg
gaacacctgaatacaacagaccccaacagtactttccgctgtgtccagatgttggaatgg
tttgagcatcatggtcacatttgcattgtttttgaactactgggacttagtacttacgac
ttcattaaagaaaatggttttctaccatttcgactggatcatatcagaaagatggcgtat
cagatatgcaagtctgtgaattttttgcacagtaataagttgactcacacagacttaaag
cctgaaaacatcttatttgtgcagtctgactacacagaggcatataatcccaaaataaaa
cgtgatgagcgcaccttagtaaatccagatattaaagttgtagactttggtagtgcaaca
tatgatgacgaacatcacagtacattggtatctacaagacattatagagcacctgaagtt
attttagccctagggtggtcccaaccatgtgatgtctggagtataggatgcattcttatt
gaatactatcttgggtttaccgtatttccaacacacgatagtaaggagcatttagcaatg
atggaaaggattcttggacctctaccaaaacatatgattcagaaaaccaggaaacgtaaa
tattttcaccacgatcgattagactgggatgaacacagttctgccggcagatatgtttca
agacgctgtaaacctctgaaggaatttatgctttctcaagatgttgaacatgagcgtctc
tttgacctcattcagaaaatgttggagtatgatccagccaaaagaattactctcaaagaa
gccttaaagcatcctttctttgaccttctgaagaaaagtatatag

DBGET integrated database retrieval system