KEGG   Pongo abelii (Sumatran orangutan): 100458475Help
Entry
100458475         CDS       T01416                                 

Gene name
GALC
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100458475 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100458475 (GALC)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100458475 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 685 aa AA seqDB search
MAEWLLSASWQRRVKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFNWPYVNLQLTAYYVVTWIV
GAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLD
AELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDTGAGCWGRILNQNYINGY
MTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVDSPVWVSAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEI
PELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLNLHEDELFTLTTLTTGRKGSYPLP
PKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPIT
WAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIF
ANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFSSGMLNDKSLWTDIPVNFPK
NGWAAIGTHSFEFAQFDNFHVEATR
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtggctactctcggcttcctggcaacgccgagtgaaagctatgacggccgcc
gcgggttcggcgggccgcgccgcggtgcccttgctgctgtgtgcgctgctggcgcccggc
ggcgcgtacgtgctcgacgactccgacgggctgggccgggagttcgacggcatcggcgcg
gtcagcggcggcggggcaacttcccgacttctagtaaattacccagagccctatcgttct
cagatattggattatctctttaagccgaattttggtgcctctttgcatattctaaaagtg
gaaataggtggtgatgggcagacaacagatggcactgagccctcccacatgcactatgca
ctagatgagaattatttccgaggatatgagtggtggttaatgaaggaagctaagaagagg
aatcccaatattacactcattgggttgccatggtcattccctggatggctgggaaaaggt
ttcaactggccttatgtcaatcttcagctgactgcctattatgtcgtgacctggattgtg
ggcgccaagcgttatcatgatttggacattgattatattggaatttggaatgagaggtca
tataatgccaattatattaagatattaagaaaaatgctgaactatcaaggtctccagcga
gtgaaaatcatagcaagtgataatctctgggagtccatctctgcatccatgctccttgat
gccgaactcttcaaggtggttgatgttataggggctcattatcctggaacccattcagca
aaagatgcaaagttgactgggaagaagctttggtcttctgaagactttagcaccttaaat
agtgacacgggtgcaggctgctggggtcgcattttaaatcagaattatatcaatggctat
atgacttccacaatcgcatggaatttagtggctagttactatgaacagctgccttatggg
agatgcgggttgatgacggcccaggagccatggagtgggcactacgtggtagactctcct
gtctgggtatcagctcataccactcagtttactcaacctggctggtattacctgaagaca
gttggccatttagagaaaggaggaagctacgtagctctgactgatggcttagggaacctc
accatcatcattgaaaccatgagtcataaacattctaagtgcatacggccatttcttcct
tatttcaatgtgtcacaacaatttgccacctttgttcttaagggatcttttagtgaaata
ccagagctacaggtatggtataccaaacttggaaaaacatccgaaagatttctttttaag
cagctggattctctatggctcctcgacagcgatggcagtttcacactgaacctgcatgaa
gatgagctgttcacactcaccactctcaccactggtcgcaaaggcagctacccgcttcct
ccaaaatcccagcccttcccaagtacctataaggatgatttcaatgttgattacccattt
tttagtgaagctccaaactttgctgatcaaactggtgtatttgaatattttacaaatatt
gaagaccctggcgagcatcacttcacgctacgccaggttctcaaccagagacccattacg
tgggctgccgatgcatccaacacaatcagtatcataggagactacaactggaccaatctg
actataaagtgtgatgtttacatagagacccctgacacaggaggtgtgttcattgcagga
agagtaaataaaggtggtattttgattagaagtgccagaggaattttcttctggattttt
gcaaatggatcttacagggttacaggtgatttagccggatggattatatatgctttagga
cgtgttgaagttacagcaaaaaaatggtatacactcacgttaactattaagggtcatttc
tcctctggcatgctgaatgacaagtctctgtggacagacatccctgtgaattttccaaag
aatggctgggctgcaattggaactcactcctttgaatttgcacagtttgacaactttcat
gtggaagccacacgctag

DBGET integrated database retrieval system