KEGG   Pongo abelii (Sumatran orangutan): 100458661Help
Entry
100458661         CDS       T01416                                 

Definition
acyl-protein thioesterase 2-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pon00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 234 aa AA seqDB search
MWCMCGNTMSVPLLTDAATVSGAERETAVVIFLHGLGDTGHSWAYALSTIRLPHVKYICP
HVPRIPVTLNMKMVMPSWFDLMGLGPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRII
LGGFSQGGALSLYTALTCPHPLAGIVVLSCGLPLHRALPQAANGSAKDLAILQCHGELDP
MVPVRFGALTAEKLRSVVIPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgtatgtgtggtaacaccatgtctgtgcctctgctcaccgatgctgccaccgtg
tctggagctgagcgggaaacggccgtggttatttttttacatggacttggagacacaggg
cacagctgggcttacgccctctccaccatccggctccctcatgtcaagtacatctgtccc
catgtgcctaggatccctgtgaccctcaacatgaagatggtgatgccctcctggtttgac
ctgatggggctgggtccagatgccccagaggacgaggctggcatcaaaaaggcagcagag
aacatcaaggccttgattgagcatgaaatgaagaatgggatccctgccaatcgaatcatc
ctgggaggcttttcacagggcggggccctgtccctctacacggccctcacctgcccccac
cctctggctggcatcgtggtgttgagctgcgggctgcctctgcaccgggccttaccccag
gcagctaatggcagtgccaaggacctggccatcctccagtgccatggggagctggacccc
atggtgcctgtacggtttggggctctgacggctgagaagctccggtctgttgtcatacct
gccagggtccagttcaagacatacccgggtgtcatgcacagctcctgtcctcaggagatg
gcagctgtgaaggaatttcttgagaagctgctgcctcctgtctaa

DBGET integrated database retrieval system