KEGG   Pongo abelii (Sumatran orangutan): 100458856Help
Entry
100458856         CDS       T01416                                 

Gene name
USP43
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 43 isoform X1
  KO
K11856  ubiquitin carboxyl-terminal hydrolase 43 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100458856 (USP43)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100458856 (USP43)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100458856 (USP43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 100458856
NCBI-ProteinID: XP_024090834
Ensembl: ENSPPYG00000007972
Position
17
AA seq 1123 aa AA seqDB search
MDLGPGDAAGGGLLAPRPRRRRSLRRLFSRFLLALGSRSRPGDSPPRPQPGHCDGDGEGG
FACAPGPVPAAPGSPGEERPPGPQPQLQLPAGDGARPPGAQGLKNHGNTCFMNAVVQCLS
NTDLLAEFLALGRYRAAPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGSQFQG
NSQHDALEFLLWLLDRVHEDLEGSSRGPVSEKLPPEATKTSENCLSPSAQLPLGQSFVQS
HFQAQYRSSLTCPHCLKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFPSKSQRFLRVGLAV
PILSTVAALRKMVAEEGGIPADEVILVELYPSGFQRSFFDEEDLNTIAEGDNVYAFQVPP
SPSPGTLSAHPLGLSVSPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFL
IREDRAVSWAQLQQSILSKVRHLMKSEAPLQNLGSLFSIRVVGLSVACSYLSPKDSRPLC
HWAVDRVLHLRRPGGPPHVKLAVEWDSSVKERLFGSLQEERAQDADSVWQQQQAHQQHSC
TLDECFQFYTKEEQLAQDDAWKCPHCQVLQQGMVKLSLWTLPDILIIHLKRFCQVGERRN
KLSTLVKFPLSGLNMAPHVAQRSTSPEAGLGPWPSWKQPDCLPTSYPLDFLYDLYAVCNH
HGNLQGGHYTAYCRNSLDGQWYSYDDSTVEPLREDEVNTRGAYILFYQKRNSIPPWSASS
SMRGSTSSSLSDHWLLRLGSHAGSTRGSLLSWSSAPCPSLPQVPDSPIFTNSLCNQEKGG
LEPRRLVRGVKGRSISMKAPTTSRAKQGPFKTMPLRWSFGSKEKPPGASVELVEYLESKR
RPRSTSQSIVSLLTGTAGEDEKSASPRSNVALPANSEDGGRATERGPARVPCPSAQSNHC
LAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARLEGQKAMNWKESFQ
MGSKSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNERAEVSPQV
PPVSLVSGRLSPAMDGQAAGSPPALRIPEGLARGLGSRLERDVWSAPSSLRLPRKASRAP
RGSALGMSQRTVPGEQASYGTFQRVKYHTLSLGRKKTLPESSF
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atggacctgggccccggggacgcggcaggagggggactgctcgcgccccggccccgccgc
cgccgctccctgcgccgcctgttcagccgcttcctgctggcgctgggcagccgctcacgc
cccggggactcgccgccccggccccagccgggacactgtgatggcgacggtgaggggggc
ttcgcctgcgccccgggcccagttccagcggcccccgggagccccggggaggagcgcccg
cccggaccccagccccagctccagctccccgccggcgatggggcgcggccgccgggcgct
cagggcttgaagaaccacggcaacacctgtttcatgaacgccgtggtgcagtgtctcagc
aacaccgacctgctggccgagttcctggcgctagggcgctatcgggcggcgccgggccgc
gccgaggtcaccgagcagctggcggcgctggtgcgcgcgctctggactcgcgaatacacg
ccccaactttccgccgagttcaagaatgcagtttccaagtacggctctcagttccaaggc
aattcccagcacgacgccctggaattcctgctctggttgctggatcgtgtacatgaggac
ctggagggttcatcccgagggccggtgtcagagaagcttccgcctgaagccactaaaacc
tctgagaactgcctgtcaccatcagctcagcttcctctaggtcaaagctttgtgcaaagc
cactttcaagcacaatatagatcttccttgacttgtccccactgcctgaaacagagcaac
acctttgatcctttcctgtgtgtgtccctacccatccccttgcgccagacgaggttcttg
agtgtcacgttggtcttcccctctaagagccagcggttcctgcgggttggcctggccgtg
ccgatcctcagcacagtggcagccctgaggaagatggttgcagaggaaggaggcatccct
gcagatgaggtgatcttggttgaactgtatcccagtggattccagcggtctttctttgat
gaagaggacctgaataccatcgcagagggagataatgtgtatgcctttcaagttcctccc
tcacccagcccggggactctctcagctcatccactgggtctgtcggtctccccacgcctg
gcagcccgtgagggacagcgattctccctctctctccacagtgagagcaaggtgctaatc
ctcttctgtaacttggtggggtcagggcagcaggctagcaggtttgggccacccttcctg
ataagggaagacagagctgtttcctgggcccagctccagcagtctatcctcagcaaggtc
cgccatcttatgaagagtgaggcccctttacagaacctagggtctctgttctccatccgt
gtcgtgggactctctgtggcctgcagctatttgtctccgaaggacagtcggcccctctgt
cactgggcagttgacagggttttgcatctcaggaggccaggaggccctccacatgtcaag
ctggcggtggagtgggacagctctgtcaaggagcgcctgttcgggagcctccaggaggag
cgggcgcaagatgccgacagcgtgtggcagcagcagcaggcgcaccagcagcacagctgt
actttggatgaatgttttcagttctacaccaaggaggagcagctggcccaggacgacgcc
tggaagtgtccccactgccaagtcctgcagcaggggatggtgaagctgagtttgtggacg
ctgcctgacatcctcatcatccacctcaaaaggttctgccaggtgggcgagagaagaaac
aagctctccacgctggtgaagtttccgctctctggactcaacatggctccccatgtggcc
cagagaagcaccagccccgaggcaggactaggcccctggccttcctggaagcagccggac
tgcctgcccaccagttacccgctggacttcctgtacgacctgtacgccgtctgcaaccac
cacggcaacctgcaaggtgggcattacacagcctactgccggaactctctggatggccag
tggtacagttatgatgacagcacggtggaaccgcttcgagaagatgaggtcaacaccaga
ggggcttacatcctgttctatcagaagcggaatagcatccctccctggtcagccagcagc
tccatgagaggctctaccagctcctccctgtccgatcactggctcctacggctcgggagc
cacgctggcagcacaaggggaagcctgctgtcctggagctctgccccctgcccctccctg
ccccaggttcccgactctcccatcttcaccaacagcctctgcaatcaggaaaagggaggg
ttggagcccaggcgtttggtacggggcgtgaaaggcagaagcattagcatgaaggcaccc
accacttcccgagccaagcagggaccattcaagaccatgcctctgcggtggtcctttgga
tccaaggagaaaccaccaggtgcctccgtcgagttggtggagtacttggaatccaaacga
agacctcggtccacgagccagtccattgtgtcgctgttgacgggcactgcgggtgaggat
gagaagtcagcatcgccgaggtccaacgttgcccttcctgctaacagcgaagatggtggg
cgggccactgaaagaggtccagccagggtaccctgtccgtcggctcaatccaaccactgt
ctggcccctggaaactcagatggtccaaacaccgcaaggaaactcaaggaaaatgcaggg
caggacatcaagcttcccagaaagtttgacctgcctctcactgtgatgccttcggtggag
catgagaaaccagctcgactggagggccagaaggccatgaactggaaggagagcttccag
atgggaagcaaaagcagcccaccctccccctatatgggattctctggaaacagcaaagac
agtcgccgaggcacctctgagctagacagacccctgcaggggacactcacccttctgagg
tccgtgtttcggaagaaggagaacaggaggaatgagagggcagaggtctctccacaggtg
ccccccgtctccctggtgagtggcaggctgagtcctgccatggatgggcaggctgcaggc
tcacctcctgccctcaggatcccagagggcctggccaggggcctgggcagccggctcgag
agggatgtctggtcagcccccagctctctccgcctccctcgtaaagccagcagggccccg
agaggcagtgcactgggcatgtcacagaggactgttccaggggagcaggcttcttatggc
acctttcagagggtcaaataccacactctttctttaggtcgaaagaaaaccttaccggag
tccagcttttga

DBGET integrated database retrieval system