KEGG   Pongo abelii (Sumatran orangutan): 100458885Help
Entry
100458885         CDS       T01416                                 

Gene name
USP25
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 25 isoform X1
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100458885 (USP25)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100458885 (USP25)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100458885 (USP25)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100458885 (USP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
21
AA seq 1087 aa AA seqDB search
MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAK
TPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRET
GITDEEQAISRVLEASIAENKACLKRTPAEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWF
SAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYV
DPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFY
GRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIK
RLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSG
SIPSQTLPSTTEQQGAPSSELPSTSPSSVAAISSRSVIHKPFTQSRIPPDLPMHPAPRHI
TEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHE
GQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKAQ
FLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQ
KLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIRIITKASHEHEDKSPETVLQSI
MMTPNMQGIIMAIGKSRSVYDRCGPEAGFFKAIKLEYARLVKLAQEDTPPETDYRLHHVV
VYFIQNQAPKKIIEKTLLEQFGDRNLSFDERCHNIMKVAQSKLEMIKPEEVNLEEYEEWH
QDYRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKGLLSKGLYRGHDEELISHYR
RECLLKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNR
WCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIKSFHEPPKLPSYSTHELCERFARIMLSLS
RTPADGR
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcagaacgtgctgcagcagagcgcggcacagaagcaccagcagacgttt
ttgaatcaactgagagaaattacggggattaatgacacccagatactacagcaagccttg
aaggatagtaatggaaacttggaattagcagtggctttccttactgcgaagaatgctaag
acccctcagcaggaggagacaacttactaccaaacagcacttcctggcaatgacagatac
atcagtgtgggaagccaagcagacacaaatgtgattgatctcactggagatgataaagat
gatcttcagagagcaattgccttgagtttggccgaatcaaacagggcattcagggagact
ggaataactgatgaggaacaagccattagcagagttcttgaagccagcatagcagagaat
aaagcatgtttgaagaggacacctgcagaagtttggagagattctcgaaacccttatgat
agaaaaagacaggacaaagctcccgttgggctaaagaatgttggcaatacttgttggttt
agtgctgttattcagtcattatttaatcttttggaatttagaagattagttctgaattac
aagcctccatcaaatgctcaagatttaccccgaaaccaaaaggaacatcggaatttgcct
tttatgcgtgagctgaggtatctatttgcacttcttgttggtaccaaaaggaagtatgtt
gatccatcaagagcagttgaaatccttaaggatgctttcaaatcaaatgactcacagcag
caagatgtgagtgagtttacacacaaattattagattggttagaagatgccttccaaatg
aaagctgaagaggagacggatgaagagaagccaaagaaccccatggtagagttgttctat
ggcagattcctggctgtgggagtacttgaaggtaaaaaatttgaaaacactgaaatgttt
ggtcagtacccacttcaggtcaatgggttcaaagatctgcatgagtgcctagaagctgca
atgattgaaggagaaattgagtctttacattcagagaattcaggaaaatcaggccaagag
cattggtttactgaattaccacctgtgttaacatttgaattgtcaagatttgaatttaat
caggcattgggaagaccagaaaaaattcacaacaaattagaatttccccaagttttatat
ttggacagatacatgcacagaaacagagaaataacgagaattaagagggaagagatcaag
agactgaaagattacctcacagtattacaacaaaggctagaaagatatttaagctatggt
tccggtcccaaacgattccccttggtagatgttcttcagtatgcattggaatttgcctca
agtaaacctgtttgcacttctcctgttgacgatattgatgctagttccccacctagtggt
tccataccatcacagacattaccaagcacaacagaacaacagggtgccccatcttcagaa
ctgccaagcacatcaccttcatcagttgctgccatttcatcgagatcagtaatacacaaa
ccatttactcagtcccggatacctccagatttgcccatgcatccggcaccaaggcacata
acggaggaagaactttctgtgctggaaagttgtttacatcgctggaggacagaaatagaa
aatgacaccagagatttgcaggaaagcatatccagaatccatcgaacaattgaattaatg
tactctgacaaatctatgatacaagttccttatcgattacatgccgttttagttcatgaa
ggccaagctaatgctgggcactactgggcgtatatttttgatcatcgtgaaagcaggtgg
atgaagtacaatgatattgctgtgacaaaatcatcatgggaagagctagtgagggactct
tttggtggttatagaaatgccagtgcatactgtttaatgtacataaatgataaggcacag
ttcctaatacaagaggagtttaataaagaaactgggcagccccttgttggtatagaaaca
ttaccaccggatttgagagattttgttgaggaagacaaccaacgatttgaaaaagaacta
gaagaatgggatgcacaacttgcccagaaagctttgcaggaaaagcttttagcgtctcag
aaattgagagagtcagagacttctgtgacaacagcacaagcagcaggagacccagaatat
ctagagcagccatcaagaagtgatttctcaaagcacttgaaagaagaaactattcgaata
attaccaaggcatcacatgagcatgaagataaaagtcctgaaacagttttgcagtcgatc
atgatgacaccgaacatgcaaggtattatcatggcgataggtaaatccaggagtgtatat
gacaggtgtggccctgaagcagggttctttaaggcaattaagttggaatatgcaaggttg
gttaagttggcccaagaagacaccccaccagaaaccgattatcggttacatcatgtagtg
gtctactttatccagaaccaggcaccaaagaaaattattgagaaaacattgctagaacaa
tttggagatagaaatttgagttttgatgaaaggtgtcacaacataatgaaagttgctcaa
agcaaactggaaatgataaaacctgaagaagtaaacttggaggaatatgaggagtggcat
caggattataggaaattcagggaaacaactatgtatctcataattgggctagaaaatttt
caaagagaaagttatatagattccttgctgttcctcatctgtgcttatcagaataacaaa
ggactcttgtctaaaggcttatacagaggacatgatgaagaattgatatcacattatagg
agagaatgtttactaaaattaaatgaacaagctgcagaactcttcgaatctggagaggat
cgagaagtaaacaatggtctgattatcatgaatgagtttattgtcccatttttgccatta
ttactggtggatgaaatggaagaaaaagatatactagctgtagaagatatgagaaatcga
tggtgttcctaccttggtcaagaaatggaaccacacctccaagaaaagctgacagatttt
ttgccaaaactgcttgattgttctatggagattaaaagtttccatgagccaccgaagtta
ccttcatattccacgcatgaactctgtgagcgatttgcccgaatcatgttgtccctcagt
cgaactcctgctgatggaagataa

DBGET integrated database retrieval system