KEGG   Pongo abelii (Sumatran orangutan): 100458998Help
Entry
100458998         CDS       T01416                                 

Gene name
ASPDH
Definition
(RefSeq) aspartate dehydrogenase domain containing
Organism
pon  Pongo abelii (Sumatran orangutan)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 283 aa AA seqDB search
MADRSPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNL
AAFGERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA
VFVARGALWGTEDIRRLDAAGGLQSLRVTMATHPDGFRLEGPLAAAHSTGPCTVLYEGPV
RGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADLSLTDMHVVDVELSGPPGPTGRSF
AVHTHRENPAEPGAVTGSATVTAFWRSLLACCQLPSRPGIHLC
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaggagcccgtggagggtgggcgtggtgggctatggccgcctcggacagtcc
ctcgtctcccgcctcttggctcagggaccagaacttggcctagaacttgtttttgtctgg
aatcgtgacccaggacgaatggcagggagcgtgcccccttccctgcagctccagaacctt
gctgcctttggggaaaggcaccctgatctggttgtggaagtggcccatcccaaaataatc
catgaatctggggcacaaatcctgcgccatgccaatctcctggtggggtccccctcagct
ctaagtgaccagaccacagagcgacagctcttggaggcctcacagcactgggaccacgcc
gtgtttgtggcccgaggggccctgtggggcactgaggacatcaggagattggatgcagct
gggggcctccagagccttcgtgtcaccatggccacacaccccgatggcttccggcttgag
ggacccctggctgcagcccacagcactgggccttgcactgtgctctacgaaggccctgtc
cgtgggctctgcccctttgccccccgaaattccaacaccatggcggcggctgccctggct
gcccccagcctgggcttcgatggggtgattggagtgcttgtggctgatctcagcctcacg
gacatgcacgtggtggatgtagagctgagcggacccccgggccccacgggccgaagcttt
gctgtgcacacccacagagagaaccctgccgagccaggcgcggtcaccggctccgccacc
gtcacggccttctggcggagcctcctggcctgctgccagctcccctccaggccggggatc
catctctgctga

DBGET integrated database retrieval system