KEGG   Pongo abelii (Sumatran orangutan): 100458998Help
Entry
100458998         CDS       T01416                                 

Gene name
ASPDH
Definition
(RefSeq) aspartate dehydrogenase domain containing
  KO
K06989  
aspartate dehydrogenase [EC:1.4.1.21]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100458998 (ASPDH)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.21  aspartate dehydrogenase
     100458998 (ASPDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
19
AA seq 283 aa AA seqDB search
MADRSPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNL
AAFGERHPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA
VFVARGALWGTEDIRRLDAAGGLQSLRVTMATHPDGFRLEGPLAAAHSTGPCTVLYEGPV
RGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADLSLTDMHVVDVELSGPPGPTGRSF
AVHTHRENPAEPGAVTGSATVTAFWRSLLACCQLPSRPGIHLC
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaggagcccgtggagggtgggcgtggtgggctatggccgcctcggacagtcc
ctcgtctcccgcctcttggctcagggaccagaacttggcctagaacttgtttttgtctgg
aatcgtgacccaggacgaatggcagggagcgtgcccccttccctgcagctccagaacctt
gctgcctttggggaaaggcaccctgatctggttgtggaagtggcccatcccaaaataatc
catgaatctggggcacaaatcctgcgccatgccaatctcctggtggggtccccctcagct
ctaagtgaccagaccacagagcgacagctcttggaggcctcacagcactgggaccacgcc
gtgtttgtggcccgaggggccctgtggggcactgaggacatcaggagattggatgcagct
gggggcctccagagccttcgtgtcaccatggccacacaccccgatggcttccggcttgag
ggacccctggctgcagcccacagcactgggccttgcactgtgctctacgaaggccctgtc
cgtgggctctgcccctttgccccccgaaattccaacaccatggcggcggctgccctggct
gcccccagcctgggcttcgatggggtgattggagtgcttgtggctgatctcagcctcacg
gacatgcacgtggtggatgtagagctgagcggacccccgggccccacgggccgaagcttt
gctgtgcacacccacagagagaaccctgccgagccaggcgcggtcaccggctccgccacc
gtcacggccttctggcggagcctcctggcctgctgccagctcccctccaggccggggatc
catctctgctga

DBGET integrated database retrieval system