KEGG   Pongo abelii (Sumatran orangutan): 100459025Help
Entry
100459025         CDS       T01416                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8
  KO
K06591  integrin beta 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04514  Cell adhesion molecules (CAMs)
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05410  Hypertrophic cardiomyopathy (HCM)
pon05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
pon05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100459025 (ITGB8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100459025 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    100459025 (ITGB8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100459025 (ITGB8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100459025 (ITGB8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100459025 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100459025 (ITGB8)
   05414 Dilated cardiomyopathy (DCM)
    100459025 (ITGB8)
  Infectious diseases
   05165 Human papillomavirus infection
    100459025 (ITGB8)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100459025 (ITGB8)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin beta subunits
   100459025 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 100459025
NCBI-ProteinID: XP_002818218
Ensembl: ENSPPYG00000017749
UniProt: H2PMQ3
Position
7
AA seq 769 aa AA seqDB search
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLSQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISDGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYLNITAICPDGSRKPGMEGCR
NVTSNDEVLFNVTVTMKKCDLTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctcggccctggctttttttaccgctgcatttgtctgcctgcaaaacgaccgg
cgaggtcccgcctcgttcctctgggcagcctgggtgttttcacttgttcttggactgagc
caaggtgaagacaatagatgtgcatcttcaaatgcagcatcctgtgccaggtgccttgcg
ctgggtccagaatgtggatggtgtgttcaagaggatttcatttcagatggatcaagaagt
gaacgttgtgatattgtttccaatttaataagcaaaggctgctcagttgattcaatagaa
tacccatctgtgcatgttataatacccactgaaaatgaaattaatacccaggtgacacca
ggagaagtgtctatccagctgcgtccaggagctgaagctaattttatgctgaaagttcat
cctctgaagaaatatcctgtggatctttattatcttgttgatgtctcagcatcaatgcac
aataatatagaaaaattaaattccgttggaaacgatttatctagaaaaatggcatttttc
tcccgtgactttcgtcttggatttggctcatacgttgataaaacagtttcaccatacatt
agcatccaccccgaaaggattcataatcaatgcagtgactacaatttagactgcatgcct
ccccatggatacatccatgtgctgtctttgacagagaacatcactgagtttgagaaagca
gttcatagacagaagatctctggaaacatagatacaccggaaggaggttttgacgccatg
cttcaggcagctgtctgtgaaagtcatattggatggcgaaaagaggctaaaagattgctg
ctggtgatgacagatcagacatctcatcttgctcttgatagcaaattggcaggcatagtg
gtgcccaatgacggaaactgccatctgaaaaacaatgtctacgtcaaatcgacaaccatg
gaacatccctcactaggccaactttcagagaaattaatagacaacaacattaatgtcatc
tttgcagttcaaggaaaacaatttcattggtataaggatcttctacccctcttgccgggc
accattgctggtgaaatagaatcaaaggctgcaaacctcaataatttggtagtggaagcc
tatcagaagctcatttcagaagtgaaagttcaggtggaaaaccaggtacaaggcatctat
ttgaacattaccgccatctgtccagatgggtccagaaagccaggcatggaaggatgcaga
aatgtgacgagcaatgatgaagttcttttcaatgtaacagttacaatgaaaaaatgtgat
ctcacaggaggaaaaaactatgcaataatcaaacctattggttttaatgaaaccgctaaa
attcatatacacagaaactgcagctgtcagtgtgaggacaacagaggacctaaaggaaag
tgtgtagatgaaacttttctagattccaagtgtttccagtgtgatgagaataaatgtcat
tttgatgaagatcagttttcttctgagagttgcaagtcacacaaggatcaacctgtttgc
agtggtcgaggagtttgtgtttgtggcaaatgttcatgtcacaaaattaagcttggaaaa
gtgtatggaaaatactgtgaaaaggatgatttttcttgtccatatcaccatggaaatctg
tgtgctgggcatggagagtgtgaagcaggcagatgccaatgcttcagtggctgggaagga
gatcggtgccagtgcccttcagcagcagcccagcactgtgtcaattcaaagggccaagtg
tgcagtggaagaggcacgtgtgtgtgtggaaggtgtgagtgcaccgatcccaggagcatc
ggccgcttctgtgaacactgccccacctgttatacggcctgcaaggaaaattggaattgt
atgcaatgccttcaccctcacaatttgtctcaggctatacttgatcagtgcaaaacctca
tgtgctctcatggaacaacagcattatgtcgaccaaacttcagaatgtttctccagccca
agctacttgagaatatttttcatcattttcatagttacattcttgattgggttgcttaaa
gtccttatcattagacaggtgatactacaatggaatagtaacaaaattaagtcctcatca
gattacagagtgtcagcctcaaaaaaggataagttgattctgcaaagtgtttgcacaaga
gcagtaacctaccgacgtgagaagcctgaagaaataaaaatggatatcagcaaattaaat
gctcatgaaactttcaggtgcaacttctaa

DBGET integrated database retrieval system