KEGG   Pongo abelii (Sumatran orangutan): 100459286Help
Entry
100459286         CDS       T01416                                 

Gene name
EGR3
Definition
(RefSeq) early growth response protein 3 isoform X1
  KO
K12497  early growth response protein 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04625  C-type lectin receptor signaling pathway
pon05161  Hepatitis B
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100459286 (EGR3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100459286 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    100459286 (EGR3)
Transcription factors [BR:pon03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100459286 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-met zf-BED zf-C2H2_6 Zf_RING zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 100459286
NCBI-ProteinID: XP_003777266
Ensembl: ENSPPYG00000018428
UniProt: H2PPS8
Position
8
AA seq 387 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPSDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctccggcagcagc
gactcggtagtccattacaatcagatggctacagagaatgtaatggacatcggtctgacc
aacgagaagcccaacccggaactctcttactccggctccttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgccaggac
aacatcattagcctcatgagcgccggcatcttgggggtgcccccggcttcaggggcgctc
agcacgcagacgtccacggccagcatggtgcagccaccgcagggtgacgtggaggccatg
tatccggcgctacccccctactccaactgcggcgacctctactcagagcccgtgtctttc
cacgacccccagggcaatcccgggctcgcctattccccccaggattaccaatcggccaag
ccggcgttggacagcaatctcttccccatgattcctgactacaacctctaccaccacccc
agcgacatgggctccattccggagcacaagcctttccagggcatggaccccatccgggtc
aacccgccccctattacccctctggagaccatcaaggcattcaaagacaagcagatccac
ccgggctttggcagcctgccccagccgccgctcaccctcaagcccatccggccccgcaag
taccccaaccggcctagcaagacaccgctccacgaacggccccacgcgtgcccggccgag
ggctgcgaccgccgtttcagccgttcggacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgccggatctgcatgcggagcttcagccgcagcgaccacctc
accactcacatccgcactcatacgggcgagaagccctttgcctgcgagttctgcgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaaggcggagaagggcggtgcaccctctgcatcctcggcgcccccagtgtcgctggcc
cccgtggtcaccacctgcgcctga

DBGET integrated database retrieval system