KEGG   Pongo abelii (Sumatran orangutan): 100459533Help
Entry
100459533         CDS       T01416                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin-2 isoform X2
  KO
K05466  angiopoietin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100459533 (ANGPT2)
   04015 Rap1 signaling pathway
    100459533 (ANGPT2)
   04010 MAPK signaling pathway
    100459533 (ANGPT2)
   04066 HIF-1 signaling pathway
    100459533 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    100459533 (ANGPT2)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100459533 (ANGPT2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100459533 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 100459533
NCBI-ProteinID: XP_002818821
Ensembl: ENSPPYG00000018319
UniProt: H2PPF8
Position
8
AA seq 495 aa AA seqDB search
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
NSVLQKQQHDLMETVNNLLTMMSTSNSKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLT
FPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVS
QLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGN
DFSTKDADHDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSG
YSLKATTMLIRPADF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagattgttttctttactctgagctgtgatcttgtcttggctgcagcctataac
aactttcggaagagcatggacagcataggaaagaagcaatatcaggtccagcatgggtcc
tgcagctacactttcctcctgccagagatggacaactgccgctcttcctccagcccctac
gtgtccaatgctgtgcagagggacgcgccgctcgaatacgatgactcggtgcagaggctg
caagtgctggagaacatcatggaaaacaacactcagtggctaatgaagcttgagaattat
atccaggacaacatgaaaaaagaaatggtagagatacagcagaatgcagtacagaaccag
acggctgtgatgatagaaatagggacaaacctgctgaaccaaacagcggagcaaacgcgg
aagttaactgatgtggaagcccaagtattaaatcagaccacgagacttgaacttcagctc
ttggaacactccctctcgacaaacaaattggaaaaacagattttggaccagaccagtgaa
ataaacaaattgcaagacaagaacagtttcctagaaaagaaggtgctagctatggaagac
aagcacatcatccaactacagtcaataaaagaagagaaagatcagctacaggtgttagta
tccaagcaaaattccatcattgaagagctagaaaaaaaaatagtgactgccacggtgaat
aattcagttcttcaaaagcagcaacatgatctcatggagacagttaataacttactgact
atgatgtccacatcaaactctaaggaccccactgttgctaaagaagaacaaatcagcttc
agagactgtgctgaagtattcaaatcaggacacaccacgaatggcatctacacgttaaca
ttccctaattctacagaagagatcaaggcctactgtgacatggaagctggcggaggcggg
tggacaattattcagcgacgtgaggatggcagcgttgattttcagaggacttggaaagaa
tataaagtgggatttggtaacccttcaggagaatattggctggggaatgagtttgtttcg
caactgactaatcagcaacgctacgtgcttaaaatacaccttaaagactgggaagggaat
gaggcttactcattgtatgaacatttctatctctcaagtgaagaactcaattataggatc
caccttaaaggacttacagggacagccggcaaaataagcagcatcagccaaccaggaaat
gattttagcacaaaggatgcagaccacgacaaatgtatttgcaaatgttcacaaatgcta
acaggaggctggtggtttgatgcatgtggtccttccaacttgaacggaatgtactatcca
caaaggcagaacacaaataagttcaacggcattaagtggtactactggaaaggctcaggc
tattcgctcaaggccacaaccatgctgatccgaccagcagatttctaa

DBGET integrated database retrieval system