KEGG   Pongo abelii (Sumatran orangutan): 100459562Help
Entry
100459562         CDS       T01416                                 

Gene name
MMP8
Definition
matrix metallopeptidase 8 (neutrophil collagenase)
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     100459562 (MMP8)
Peptidases [BR:pon01002]
 Metallo Peptidases
  Family M10
   100459562 (MMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 465 aa AA seqDB search
MFSLKTLPFLLLLHVQISKAFPVSSKEKNTKIVQDYLEKFYQLPSNQYQSTRKNGTNVIV
EKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGEFMLTPGNPKWERTNLTYRIRNY
TPQLSEDDVKTAIEKAFEVWSKASPLTFTRISQGEADINIAFYQRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDVHFDAEETWTKTSANYNLFIVAAHEFGHSLGLAHSSDPGALMYPNYA
FRETSNYSLPQDDIDGHSSLYGPSSNPVQPTGPSTPKPCDPSLTFDAITTLRGEILFFKD
KYFWRRHPQLQRIEMNFISLFWPSLPTGMQAAYEDFDRDLIFLFKGNQYWALSGYDILQG
YPKNISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISDTFPGI
ESKVDAVFQQEHFFLFFSGPRYYAFDLIAQRVTRVARGNKWLNCR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctgaagacgcttccatttctgctcttactccatgtgcagatttccaaggcc
tttcctgtatcttctaaagagaaaaatacaaaaattgttcaggactacctggaaaagttc
taccaattaccaagcaaccagtatcagtctacaaggaaaaatggcactaatgtgattgtt
gaaaagcttaaagaaatgcagcgattttttgggttgaatgtgacggggaagccaaatgag
gaaactctggacatgatgaaaaagcctcgctgtggagtgcctgacagtggtgaatttatg
ttaaccccaggaaaccccaagtgggaacgcactaacttgacctacaggattcgaaactat
accccacagctgtcagaggatgatgtaaaaacagctattgagaaagcctttgaagtctgg
agtaaggcatcacctcttaccttcaccaggatctcacagggagaggcagatatcaacatt
gctttttaccaaagagatcacggtgacaattctccatttgatggacccaatggaatcctt
gctcatgcctttcagccaggccaaggtattggaggagatgttcattttgatgccgaagaa
acatggaccaaaacctccgcaaattacaacttgtttattgttgctgctcatgaatttggc
cattctttggggcttgctcactcctctgaccctggtgccttgatgtatcccaactatgct
ttccgggaaaccagcaactactcactccctcaagatgacatcgatgggcattcaagcctt
tatggaccttcaagcaaccctgtccaacctactggaccaagcacacccaaaccctgtgac
cccagtttgacatttgatgctattaccacactccgtggagaaatacttttctttaaagac
aagtacttctggagaaggcatcctcagctacaaagaatcgaaatgaattttatttctcta
ttctggccatcccttccaactggtatgcaggctgcttatgaagattttgacagagacctc
attttcctatttaaaggcaaccaatactgggctctgagtggctatgacattctgcaaggt
tatcccaagaatatatcaaactatggcttccccagcagtgtccaagcaattgacgcagct
gttttctacagaagtaaaacatacttctttgtaaatgaccaattctggagatatgataac
caaagacaattcatggaaccaggttatcccaaaagcatatcagatacctttccaggaata
gagagtaaagttgatgcagttttccagcaagaacacttcttccttttcttcagtggacca
agatattacgcatttgatcttattgctcagagagttaccagagttgcgagaggcaataaa
tggcttaactgtagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system