KEGG   Pongo abelii (Sumatran orangutan): 100459691Help
Entry
100459691         CDS       T01416                                 

Gene name
ALDH1L2
Definition
(RefSeq) mitochondrial 10-formyltetrahydrofolate dehydrogenase isoform X1
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100459691 (ALDH1L2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100459691 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 100459691
NCBI-ProteinID: XP_024112988
Ensembl: ENSPPYG00000004898
Position
12
AA seq 923 aa AA seqDB search
MLRRGSQALRRFSTGRVYFKSKLKLALIGQSLFGQEVYSHLCKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEEVKVAETIKDIWAGILSNVP
VIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEVELVVDYISKEVNEMMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTIGKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD
VDGVLQRANNTEFGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcggggcagccaggcgctccggcgcttctccactggccgggtttatttcaaa
agcaagctgaagttggcactaattggccagagcctctttggacaagaagtctatagccac
ctctgcaaagagggccaccgagtagtaggggtgttcacggttccagacaaggatggaaaa
gctgaccctctggctttggctgcagagaaagatgggacccctgtgttcaagcttcctaaa
tggagggtcaagggcaagaccatcaaagaggtggcagaagcctacagatctgtgggtgca
gagctaaatgtgctccctttctgcactcagttcattcccatggatataattgatagtcca
aagcatggctctatcatttatcacccatccatcctgcccaggcacagaggagcctctgct
atcaattggactctaattatgggagataagaaagctgggttttctgttttctgggctgac
gatggcttggatacaggacccatccttcttcagagatcatgtgatgttgaacccaatgat
acagtggatgcactttataatcggtttctttttcctgaaggaatcaaggccatggtagaa
gctgtccaactcatagctgatggaaaagctcctcgtataccccagccagaagaaggggca
acatatgaaggtatccagaaaaaagaaaatgctgagatttcttgggaccagtctgccgaa
gttttacataactggattcgaggtcatgataaagtccctggagcttggacagagataaat
ggacagatggtcactttctatggctcgacattactaaatagctctgtgcctcctggagaa
ccactggaaattaaaggtgccaagaagcctggtctcgttaccaaaaatggacttgttctt
tttggtaacgatggaaaagcactgatggtgagaaatctgcagtttgaagatggaaaaatg
atacctgcctctcagtacttttcagcgggtgagacgtcagtggtagaactgacagcagaa
gaggtgaaagtggcagagaccatcaaggacatctgggctggaattttaagcaatgtcccc
gttattgaagactcaacagacttctttaaatctggagcaagctcaatggatgttgccagg
ctggttgaagagatcagacagaaatgtggtgggcttcagttgcagaatgaagatgtctat
atggccaccaagtttgaagactttatccaaaaggtcgtgaggaaactgagaggagaagat
caagaggtggagctggttgtagattatatttcaaaggaggtcaatgaaatgatggtaaaa
atgccgtaccagtgtttcataaatggacagttcacagatgcagacgatggaaagacttac
gacactatcaacccaacagatggatctacaataggcaaagtatcctatgcttctttggcg
gatgttgataaagcagtggcagcagcaaaagatgcttttgaaaacggtgaatggggaaga
atgaatgcaagagaaagaggaagattgatgtacagacttgcagacctactggaagagaac
caagaagagctggcaactattgaagcccttgattcaggggctgtctataccttggcgctg
aagacacacattggaatgtctgtgcaaacattcagatattttgctggctggtgtgacaaa
attcagggttctactattccaatcaaccaggcccgtccaaatcgcaatctgaccttcacc
aagaaagagccacttggtgtctgtgccattattattccctggaactacccactgatgatg
ctggcatggaagagtgctgcgtgtttggcagcaggcaataccttagtgctcaagccagca
caggtcacgcccttgactgctttgaagtttgcagaactgtctgtgaaagcaggctttcca
aagggggtcatcaacatcattccaggctcaggtggcatagcaggacaacgtctgtctgaa
catcctgacatccgcaaacttggtttcactggatccactcctattggcaaacagatcatg
aagagctgtgctgttagcaacctgaagaaagtttcccttgagcttggtggcaagtctcca
cttataatatttaatgactgtgaacttgacaaggctgtgcgaatgggcatgggagcagta
tttttcaacaaaggagagaactgtattgctgctgggcggttgtttgtggaagaatccatc
cacgacgaatttgtgacaagagtggtagaagaaattaaaaagatgaaaattggtgatcca
cttgacagatccactgatcatgggccccaaaatcataaggcccatctggaaaagctgctg
caatactgtgaaactggagtgaaagagggggctactttggtgtacgggggaagacaagtc
caaaggccaggctttttcatggagccgactgtgttcacagatgtggaagactacatgtac
ctcgccaaagaggaatcctttgggcctattatggtcatttctaaattccaaaatggggac
gtcgatggagtgttgcagcgagcaaataatacagagtttggtttggcctcaggggttttt
acaagagacataaacaaagctatgtatgtgagtgaaaaactggaagcaggaactgttttt
attaacacatacaacaagacagatgtggcggccccatttggcggagttaaacaatctggc
tttggaaaagacttaggtgaggaagctctaaatgaatatctcaaaaccaagacggtgacg
ctggaatattag

DBGET integrated database retrieval system