KEGG   Pongo abelii (Sumatran orangutan): 100459829Help
Entry
100459829         CDS       T01416                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100459829 (AGMAT)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     100459829 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 352 aa AA seqDB search
MLRLLASGCARGPGPGVGVRPAAGLCHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMM
RLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLRTVNPSTGALPFQSLM
VADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVG
LLHVDAHTDTIDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQ
GFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ
ALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggctgctggcgtccgggtgcgcccggggcccggggcccggcgtgggcgtgcgt
cctgccgcagggctctgccacccggggcgccgccagagccgccaggcttccgacgctccc
cggaaccagccccccagccccgagttcgtggcccggccggtgggcgtctgctccatgatg
cgcctgccggtgcagacctcacccgaggggctggacgctgccttcatcggggtgcccctg
gatactgggacctccaaccggcctggggcgagattcggacctcgccgcatccgggaagaa
tcagtgatgcttcggacagtcaatcctagcacgggggccctccccttccagtccctcatg
gttgcagacctaggcgatgtgaatgtcaatctttacaaccttcaggacagctgccggcga
attcaagaggcctatgagaaaattgtagcagctggctgtattcctctgaccttgggtgga
gatcacacaatcacatatcccatattgcaagcaatggcaaaaaagcatggcccagtgggg
ctgctgcatgtggatgcgcacacggacacgatcgacaaggccctaggagagaagctctac
cacggggcgcccttccgccggtgtgtggatgagggtctcctggactgtaagcgtgtggtg
cagattggcatccggggctcttccacgaccttggatccctacagatacaaccggagccag
ggcttccgggtagtcctggctgaagactgctggatgaagtcgctggttcctctgatgggg
gaagtcaggcagcagatgggaggcaaacccatttatatcagctttgatattgacgctctg
gatcctgcctatgcgccagggacaggaacacctgaaattgctggtctcactcctagtcag
gctctggagatcatcaggggttgtcaaggcctgaacgtggtgggctgtgatcttgtcgaa
gtttcaccaccatatgatctttctgggaacacagccctgctggcggctaacctgctgttt
gagatgctgtgtgctctccccaaagtgacaaccgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system