KEGG   Pongo abelii (Sumatran orangutan): 100459866Help
Entry
100459866         CDS       T01416                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100459866 (AURKA)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100459866 (AURKA)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100459866 (AURKA)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100459866 (AURKA)
Chromosome [BR:pon03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100459866 (AURKA)
   Spindle formation proteins
    100459866 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    100459866 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 404 aa AA seqDB search
MDRSKENCISGPVKVTAPVGGPKRVLVTQQFPCQNPLPANSGQAQRVLCPSNSSQRVPLQ
AQKLVSSHKPVQNQKQQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQK
NEESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITE
LANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPE
MIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDL
ISRLLKHNPSQRPMLREVLEHSWITANSSKPSNCQNKESTSKQS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaccgatctaaagaaaactgcatttcagggcctgttaaggttacagctccagttgga
ggtccaaaacgtgttctcgtgactcagcaatttccttgtcagaatccattacctgcaaat
agtggccaggctcagcgggtcctgtgtccttcaaattcttcccagcgtgttcctttgcaa
gcacaaaagcttgtctccagtcacaagccggttcagaatcagaagcagcagaagcaattg
caggcaaccagtgtacctcatcctgtctccaggccactgaataacacccaaaagagcaag
cagcccctgccgtcagcacctgaaaataatcctgaggaggaactggcatcaaaacagaaa
aatgaagaatcaaaaaagaggcagtgggctttggaagactttgaaattggtcgccctctg
ggtaaaggaaagtttggtaatgtttatttagcaagagaaaagcaaagcaagtttattctg
gctcttaaagtgttatttaaagctcagctggagaaagctggagtggagcatcagctcaga
agagaagtagaaatacagtcccaccttcggcatcctaatattctcagactgtatggttat
ttccatgacgctaccagagtctacctaattctggaatatgcaccacttggaacagtctat
agagaacttcagaaactttcaaagtttgatgagcagagaactgctacttatataacagaa
ttggcaaatgccctgtcttactgtcattcgaagagagttattcatagagacattaagcca
gagaacttacttcttggatcagccggagagcttaaaattgcagattttgggtggtcagta
catgctccatcttccaggaggaccactctctgtggcaccctggactacctgccccccgaa
atgatagaaggtcggatgcatgatgagaaggtggatctctggagccttggagttctttgc
tatgaatttttagttgggaagcctccttttgaggcaaacacataccaagagacctacaaa
agaatatcacgggttgaattcacattccctgactttgtaacagagggagccagggacctc
atttcaagactgttgaagcataatcccagccagaggccaatgctcagagaagtacttgaa
cactcctggatcacagcaaattcatcaaaaccatcaaattgccaaaacaaagaatcaacc
agcaaacagtcttag

DBGET integrated database retrieval system