KEGG   Pongo abelii (Sumatran orangutan): 100459944Help
Entry
100459944         CDS       T01416                                 

Gene name
BPNT1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100459944 (BPNT1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100459944 (BPNT1)
Transfer RNA biogenesis [BR:pon03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100459944 (BPNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 308 aa AA seqDB search
MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICS
SLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGF
QLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPE
SIKNALVP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagtaatactgtgttgatgcggttggtagcctcagcatattctattgctcaa
aaggcaggaatgatagtcagacgtgttattgctgaaggagacctgggtatcgtggagaag
acctgtgcaacagacctgcagaccaaagctgaccgattggcacagatgagcatatgttct
tcattggcccggaaattccccaaactcacaattataggcgaagaggatctgccttctgag
gaagtggatcaagagctgattgaagacagtcagtgggaagaaatactgaagcaaccatgc
ccatcgcagtacagtgctattaaagaagaagatctcgtggtctgggttgatcctctggat
ggaaccaaggaatataccgaaggtcttcttgacaatgtaacagttcttattggaattgct
tatgaaggaaaagccatagcaggagttattaaccagccatattacaactatgaggcagga
ccagatgctgtgttggggaggacaatctggggagttttaggtttaggcgcctttgggttt
cagctgaaagaagtccctgctgggaaacacattatcacaactactcgatcccatagcaac
aagttggttactgactgcgttgctgctatgaaccccgatgctgtgctgcgagtaggagga
gcaggaaataagattattcagctgattgaaggcaaagcctctgcttatgtatttgcaagt
cctggttgtaagaagtgggatacttgtgctccagaagttattttacatgctgtgggaggc
aagttaaccgatatccatgggaatgttcttcagtaccacaaggatgtgaagcatatgaac
tctgcaggagtcctggccacactgaggaattatgactactatgcaagccgagttccagaa
tctattaaaaatgcacttgttccttaa

DBGET integrated database retrieval system