KEGG   Pongo abelii (Sumatran orangutan): 100459989Help
Entry
100459989         CDS       T01416                                 

Gene name
DCK
Definition
deoxycytidine kinase
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100459989 (DCK)
   00240 Pyrimidine metabolism
    100459989 (DCK)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100459989 (DCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 260 aa AA seqDB search
MATPPKRSCPSLSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVAKWCN
VQSTQNKFEELTTSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKYESLVEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtctctctcagccagctctgaggggacccgc
atcaagaaaatctccatcgaggggaacatcgctgcagggaagtcaacatttgtgaatatc
cttaaacaattgtgtgaagattgggaagtggttcctgaacctgttgccaaatggtgcaat
gttcaaagtactcaaaataaatttgaggaacttacaacgtctcagaaaaatggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccaaacatatgcc
tgtctcagtcgaataagagctcagcttgcctctctgaatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgcatgaatgagacagagtggacaatttatcaagactggcatgac
tggatgaataaccaatttggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagaaatgcttacatagaatatatttacggggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaagcttcattataaacatgaaagctggctcctgcataggaca
ctgaaaaccaacttcgattatcttcaagaggtgcctatcttaacactggatgttaatgaa
gactttaaagacaaatatgaaagtctggttgaaaaggtcaaagaatttttgagtactttg
tga

DBGET integrated database retrieval system