KEGG   Pongo abelii (Sumatran orangutan): 100460115Help
Entry
100460115         CDS       T01416                                 

Gene name
PLOD2
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 isoform X1
  KO
K13645  
procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 [EC:1.14.11.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100460115 (PLOD2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     100460115 (PLOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3
AA seq 758 aa AA seqDB search
MGGCTVKPQLLLLALVFHPWNPCLGADSEKPSSIPTDKLLVITVATKESDGFHRFMQSAK
YFNYTVKVLGQGEEWRGGDGINSIGGGQKVRLMKEVMEHYADQDDLVVIFTECFDVIFAG
GPEEVLKKFQKANHKVVFAADGILWPDKRLADKYPVVHIGKRYLNSGGFIGYAPYVNRIV
QQWNLQDNDDDQLFYTKIYIDPLKREAINITLDHKCKIFQTLNGAVDEVVLKFENGKARA
KNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQDNGCTLCEFDTVDLSAVDVHPNVSI
GVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKAKHEIKTIKIV
GPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTNPRTLKILIEQNRKIIAPLVTR
HGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGVWNVPYMANVYLIKGKTLRSEMNERN
YFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQMLSPPKGVFMYISNRHEFGRLLSTA
NYNTSHYNNDLWQIFENPVDWKEKYINRDYSKIFTENIVEQPCPDVFWFPIFSEKACDEL
VEEMEHYGKWSGGKHHDSRISGGYENVPTDDIHMKQVDLENVWLHFIREFIAPVTLKVFA
GYYTKGFALLNFVVKYSPERQRSLRPHHDASTFTINIALNNVGEDFQGGGCKFLRYNCSI
ESPRKGWSFMHPGRLTHLHEGLPVKNGTRYIAVSFIDP
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggggggatgcacggtgaagcctcagctgctgctcctggcgctcgtcttccacccctgg
aatccctgtctgggtgcggactcggagaagccctcgagcatccccacagataaattatta
gtcataactgtagcaacaaaagaaagtgatggattccatcgatttatgcagtcagccaaa
tatttcaattatactgtgaaggtccttggtcaaggagaagaatggagaggtggtgatgga
attaatagtattggagggggccagaaagtgagattaatgaaagaagtcatggaacactat
gctgatcaagatgatctggttgtcatctttactgaatgctttgatgtcatatttgctggt
ggtccagaagaagttctaaaaaaattccaaaaggcaaaccacaaagtggtctttgcagca
gatggaattctgtggccagataaaagactagcagacaagtatcctgttgtgcacattggg
aaacgctatctgaattcaggaggatttattggctatgctccatatgtcaaccgtatagtt
caacaatggaatctccaggataatgatgatgatcagctcttttacactaaaatttacatt
gatccactgaaaagggaagctattaacatcacattggatcacaaatgcaaaattttccag
accttaaatggagctgtagatgaagttgttttaaaatttgaaaatggcaaagccagagct
aagaatacattttatgaaaccttaccagtggcaattaatggaaatggacctaccaagatt
ctcctgaattattttggaaactatgtacccaattcatggacacaggataatggctgcact
ctttgtgaattcgatacggtcgacttgtctgcagtagatgtccatccaaacgtatcaata
ggtgtttttattgagcaaccaaccccttttctacctcggtttctggacatattgttgaca
ctggattacccaaaagaagcacttaaactttttattcataacaaagaagtttatcatgaa
aaggacatcaaggtattttttgataaagctaagcatgaaatcaaaactataaaaatagta
ggaccagaagaaaatctaagtcaagcagaagccagaaacatgggaatggacttttgccgt
caggatgaaaagtgtgattattactttagtgtggatgcagatgttgttttgacaaatcca
aggactttaaaaattttgattgaacaaaacagaaagatcattgctccccttgtaactcgt
catggaaagctatggtccaatttctggggagcattgagtcctgatggatactatgcacga
tctgaagattatgtggatattgttcaagggaatagagtaggagtatggaatgtcccatac
atggctaatgtgtacttaattaaaggaaagacactccgatcagagatgaatgaaaggaac
tattttgttcgtgacaaactggatcctgatatggctctttgccgaaatgctagagaaatg
actttacaaagggaaaaagactcccctactccggaaacattccaaatgctcagcccccca
aagggtgtatttatgtacatttctaatagacatgaatttggaaggctattatccactgca
aattacaatacttctcattataacaatgacctctggcagatttttgaaaatcctgtggac
tggaaggaaaagtatataaaccgtgattattcaaagattttcactgaaaatatagttgaa
cagccctgtccagatgtcttttggttccccatattttctgaaaaagcctgtgatgaattg
gtagaagaaatggaacattatggcaaatggtctgggggaaaacatcatgatagccgtata
tctggtggttatgaaaatgtcccaactgatgatatccacatgaagcaagttgatctggag
aatgtatggcttcattttatccgggagttcattgcaccagttacactgaaggtctttgca
ggctattatacgaagggatttgcactactgaattttgtagtaaaatattcccccgaacga
cagcgttctcttcgtcctcatcatgatgcttctacatttaccataaacattgcacttaat
aacgtgggagaagactttcagggaggtggttgcaaatttctaaggtacaattgctctatt
gagtcaccacgaaaaggctggagcttcatgcatcctgggagactcacacatttgcatgaa
ggacttcctgttaaaaatggaacaagatacattgcagtgtcatttatagatccctaa

DBGET integrated database retrieval system