KEGG   Pongo abelii (Sumatran orangutan): 100460115Help
Entry
100460115         CDS       T01416                                 

Gene name
PLOD2
Definition
procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2
Orthology
K13645  
procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 [EC:1.14.11.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pon00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 909 aa AA seqDB search
MRGDPFPWLKSLARSQSAKTAADLQSLQTGWSIQVHRGANSHPSRLLWKLPGLGQQRGTQ
TEHRPPARLPAAPPPSPKPTPKAKCRLPRSSQKRCRAANSQGAARPVASPRGAYKASAAP
RAPAAPCLRRQPHSAALRAAPAAGRAPLPPAPARNRRLRAYPGLCVLARSAALRGRGRLS
PRGPRGPNMGGCTVKPQLLLLALVFHPWNPCLGADSEKPSSIPTGEHPAVRRCPARLGRR
GGSSFIHQPFRGAGQVTVKSDFTGEQFYDEECHESFHKWECLSLIVIFAGGPEKFXKKFL
KANHKVVFAADGILWPDKRLADKYPVVHIGKRYLNSGGFIGYAPYVNRIVQQWNLQDNDD
DQLFYTKIYIDPLKREAINITLDHKCKIFQTLNGAVDEVVLKFENGKARAKNTFYETLPV
AINGNGPTKILLNYFGNYVPNSWTQDNGCTLCEFDTVDLSAVDVHPNVSIGVFIEQPTPF
LPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIQVFFDKAKHEIKTIKLGXPQKNLSQAE
AQKHGNGWDFCRQDEKCDYYFSVDADVVLTNPRTLKILIEQNRKIIAPLVTRHGKLWSNF
WGALSPDGYYARSEDYVDIVQGNRVGVWNVPYMANVYLIKGKTLRSEMNERNYFVRDKLD
PDMALCRNAREMGVFMYISNRHEFGRLLSTANYNTSHYNNDLWQIFENPVDWKEKYINRD
YSKIFTENIVEQPCPDVFWFPIFSEKACDELVEEMEHYGKWSGGKHHDSRISGGYENVPT
DDIHMKQVDLENVWLHFIREFIAPVTLKVFAGYYTKGFALLNFVVKYSPERQRSLRPHHD
ASTFTINIALNNVGEDFQGGGCKFLRYNCSIESPRKGWSFMHPGRLTHLHEGLPVKNGTR
YIAVSFIDP
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcgatccatttccatggcttaagagtctggcgaggtcccagtcagccaagact
gctgcagatttgcagtcacttcagactgggtggagtatccaagtccatagaggagcaaat
tctcacccttcaaggctgctgtggaagctaccggggctgggacagcagagaggaacccag
acggaacaccgccctcccgccagactcccggcggctcctcctccctctcccaaacccact
cccaaagctaagtgcaggcttccccgttccagccagaagcgctgccgggcggccaatagc
cagggcgcggcccgccccgtcgcctcccctcggggagcctataaggcctccgcagcgccc
cgggcgcctgctgctccgtgtctccgccgacaacctcactctgctgcgttacgcgccgct
ccggctgccggccgcgcgccgctcccgcccgctcccgcccgcaatcggcggctcagggcg
tacccgggtctctgcgttctcgcgagaagcgcggcgctgcggggccgtgggcgcctgagc
ccgcgcggccctcgagggccgaatatggggggatgcacggtgaagcctcagctgctgctc
ctggcgctcgtcttccacccctggaatccctgtctgggtgcggactcggagaagccctcg
agcatccccacaggtgagcaccccgcggtccgccgctgtcccgcgaggctcggccggcgg
gggggcagttcattcatccaccagcccttccgcggggctggccaggtcacagtgaaatca
gacttcactggggagcagttttatgatgaggaatgtcatgaatcctttcacaaatgggaa
tgtctctctttgattgtcatatttgctggtggtccagaaaagttcnntaaaaaattccta
aaggcaaaccacaaagtggtttttgcagcagatggaattctgtggccagataaaagacta
gcagacaagtatcctgttgtgcacattgggaaacgctatctgaattcaggaggatttatt
ggctatgctccatatgtcaaccgtatagttcaacaatggaatctccaggataatgatgat
gatcagctcttttacactaaaatttacattgatccactgaaaagggaagctattaacatc
acattggatcacaaatgcaaaattttccagaccttaaatggagctgtagatgaagttgtt
ttaaaatttgaaaatggcaaagccagagctaagaatacattttatgaaacattaccagtg
gcaattaatggaaatggacctaccaagattctcctgaattattttggaaactatgtaccc
aattcatggacacaggataatggctgcactctttgtgaattcgatacggtcgacttgtct
gcagtagatgtccatccaaacgtatcaataggtgtttttattgagcaaccaacccctttt
ctacctcggtttctggacatattgttgacactggattacccaaaagaagcacttaaactt
tttattcataacaaagaagtttatcatgaaaaggacatccaggtattttttgataaagct
aaacatgaaatcaaaactataaaactaggatgaccacaaaaaaatctaagtcaagcagaa
gcccagaaacatgggaatggatgggacttttgccgtcaggatgaaaagtgtgattattac
tttagtgtggatgcagatgttgttttgacaaatccaaggactttaaaaattttgattgaa
caaaacagaaagatcattgctccccttgtaactcgtcatggaaagctatggtccaatttc
tggggagcattgagtcctgatggatactatgcacgatctgaagattatgtggatattgtt
caagggaatagagtaggagtatggaatgtcccatacatggctaatgtgtacttaattaaa
ggaaagacactccgatcagagatgaatgaaaggaactattttgttcgtgacaaactggat
cctgatatggctctttgccgaaatgctagagaaatgggtgtatttatgtacatttctaat
agacatgaatttggaaggctattatccactgcaaattacaatacttctcattataacaat
gacctctggcagatttttgaaaatcctgtggactggaaggaaaagtatataaaccgtgat
tattcaaagattttcactgaaaatatagttgaacagccctgtccagatgtcttttggttc
cccatattttctgaaaaagcctgtgatgaattggtagaagaaatggaacattatggcaaa
tggtctgggggaaaacatcatgatagccgtatatctggtggttatgaaaatgtcccaact
gatgatatccacatgaagcaagttgatctggagaatgtatggcttcattttatccgggag
ttcattgcaccagttacactgaaggtctttgcaggctattatacgaagggatttgcacta
ctgaattttgtagtaaaatattcccccgaacgacagcgttctcttcgtcctcatcatgat
gcttctacatttaccataaacattgcacttaataacgtgggagaagactttcagggaggt
ggttgcaaatttctaaggtacaattgctctattgagtcaccacgaaaaggctggagcttc
atgcatcctgggagactcacacatttgcatgaaggacttcctgttaaaaatggaacaaga
tacattgcagtgtcatttatagatccctaa

DBGET integrated database retrieval system