KEGG   Pongo abelii (Sumatran orangutan): 100460209Help
Entry
100460209         CDS       T01416                                 

Gene name
PLB1
Definition
phospholipase B1
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vitamin digestion and absorption
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pon00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:pon00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pon00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:pon00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:pon00592]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:pon04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2A
AA seq 1459 aa AA seqDB search
MGLRPGLFLLELLLLLGQGTPQIHTSPRKNTLEGQLWPETLKNSPFPCNPNKLGVNMPSK
SVHSLKPSDIKFVAAIGNLEIPPDPGMGDPEKQEWTEERPQQVCMGVMTVLSDIIRHFSP
SVPMPVCHTGKRVIPRDGAEDLWIQAQELVRNMKENPQLDFQFDWKLINVFFSNASQCYL
CPSAQQNGLAAGSVDKLMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHGTWLSPAPEPC
NCSEETSRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTPSLPSEDPPLQ
DSTTLAWHLWNRMMEPAGEKDEPLSAKHRRPMKCPSQESPYLFSYRNSNYLTRLQKPRDK
PEVREGAEIRCPDKDPSDTVPTSVHRLKPADINVIGALGDSLTAGNGAGSTPGNVLDVLT
QYRGLSWSVGGDESIGTVTTLANILREFNPSLKGFSVGTGKETSPNAFLNQAVAGGRAED
LPVQARRLVDLMKNDTRIHFQEDWKIITLFIGGNDLCDFCNDLVHYSPQNFTDNIGKALD
ILHAEVPRAFVNLVTVLEIVNLRELYQEKKVYCPRMILRSLCPCVLKFDDNSTELATLIE
FNKKFQEKTHQLIESGQYDTREDFTVVVQPFFENVDMPKTSEGLPDNSFFAPDCFHFSSK
SHSRAASALWNNMLEPVGQKMTRHKFENEINITCPNQVQPFLRTYKNSVQGHGTWLPCRE
RAPSALPPTSVHALRPADIQVVAALGDSLTAGNGIGSKPDDLPDVTTQYRGLSYSAGGDG
SLENVTTLPNILREFNRNLTGYAVGTGDANDTNAFLNQAVPGAKAEDLISQVQTLVQKMK
DDHRVNFHEDWKVITVLIGGSDLCDYCTDSNLYSAANFVDHLRNALDVLHGEVPRVLVNL
VDFLNPSVMRQVFLGNPDKCPVQQASVLCNCVLTLRENSQELARLEAFSRAYQSSMRELV
ESGRYDTREDFSVVLQPFFQNIQLPVLADGLPDTSFFAPDCIHPNQKFHSQLARALWTNM
LEPLGSKTETLDXRAEMPITCPTQNEPFLRTPRNSNYTYPTKPAIENWGSDFLCTEWKAS
NSVPTSVHQLRPADIKVVAALGDSLTTAVGARPNNSSDLPTSWRGLSWSIGGDGNLETHT
TLPNILKKFNPYLLGFSTSTWKGTAGLNVAAEGARARDMPAQARDLVERMKNSPDINLEK
DWKLVTLFIGGNDLCHYCENPEAHLATEYVQHIEQALDILSEELPRAFVNLVEVMELASL
YQGQGGKCAMLAAQNNCTCLRHSQSSLEKQELKKVNWNLQNGISSFSYWHQYTQREDFAV
VVQPFFQNTLTPLNERGDTDLTFFSEDCFHFSDRGHAEMAIALWNNMLEPVGRKTTSNNF
THSRAKLKCPSPESPYLYTLRNSRLLPDQAEEAPEVLYWAVPVAAGVGLVVGVIGTVVWR
CRRGGRREDPPMNLRTVAL
NT seq 4380 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcggccaggccttttcctcctggagctgctgctgcttctggggcaagggacc
cctcagatccatacctctcctagaaagaatacattggaagggcagctatggccagagacc
ctgaagaattctccattcccttgcaacccaaataaattaggagtgaatatgccttccaaa
tcagttcactctctgaagccttctgatattaaatttgtggcagccattggcaatctggaa
attcctccagacccagggatgggcgatccggagaagcaagaatggactgaagaaaggcca
cagcaggtgtgcatgggagtgatgacagtcctttcagacatcatcagacatttcagtcct
tctgttccaatgcctgtgtgccacactggaaagagagtcataccccgtgacggtgctgaa
gacttgtggattcaggctcaagaactggtgagaaacatgaaagagaacccgcaacttgac
tttcaatttgactggaagctcattaatgtattcttcagtaacgcaagccagtgttacctg
tgcccctctgctcaacagaacgggcttgcggcgggcagtgtggacaagctgatgggggtg
ctggactacctgcagcaggaggtccccagagcgtttgtaaacctggtggacctctctgag
gttgcagaggtctctcgtcagtatcacggcacttggctcagccctgcacccgagccctgt
aattgctcagaggagacctcccggctggccaaggtggtgatgcagtggtcttatcaggaa
gcctggaacagcctcctggcctccagcaggtacagtgagcaggagtccttcaccgtggtt
ttccagcctttcttctatgagaccaccccgtctctaccctcggaggaccccccactccag
gattctaccacattggcctggcatctctggaataggatgatggagccagcaggagagaaa
gatgagccattgagtgcaaaacacaggaggccaatgaagtgtccctctcaggagagcccc
tatctgttcagctacaggaacagcaactacctgaccagactgcagaaaccccgagataag
cctgaggtaagagaaggagcagaaatcagatgtcctgacaaagacccctccgatacggtt
cccacctcagttcataggctgaagccggctgacatcaacgtaattggagccctgggtgac
tctctcacagcaggcaatggggccgggtccacacctgggaatgtcttggacgtcttgact
cagtaccgaggcctgtcctggagcgtcggcggagatgagagcattggcaccgttaccacc
ctggcgaacatcctccgggaattcaacccttccctgaagggcttctctgttggcactggg
aaagaaaccagtcctaatgccttcttaaaccaggctgtggcaggaggccgagctgaggat
ttacctgtccaggccaggaggctggtggacctgatgaagaatgacacgaggatacacttt
caggaagactggaagataataaccctgtttataggtggcaatgacctctgtgatttctgc
aatgatctggttcactattctccccagaacttcacagacaacattgggaaggccctggac
atcctccatgccgaggttcctcgggcatttgtgaacctggtgacggtgcttgagattgtc
aacctgagggagctgtaccaggagaaaaaagtctactgcccaaggatgatcctcaggtct
ctgtgtccctgtgtcctgaagtttgatgataactcaacagaacttgccaccctcatcgaa
ttcaacaagaagtttcaggagaagacccaccaactgattgagagtgggcaatatgacaca
agggaagattttacagtggttgtgcagccgttctttgaaaacgtggacatgccaaagacc
tcggaaggattgcctgacaactctttcttcgctcctgactgtttccacttcagcagcaag
tctcactcccgagcagccagcgccctctggaacaatatgctggagcctgttggccagaag
atgacacgtcataagtttgaaaacgagatcaatatcacatgtccgaaccaggtccagcca
tttctcaggacctacaagaacagcgtgcagggtcatgggacctggctgccatgcagggaa
agagccccttctgccttgccccctacctcagtgcatgccctgagacctgcagacatccaa
gttgtggctgctctgggggattctctgaccgctggcaatggaattggctccaaaccagac
gacctccccgatgtcaccacacagtatcggggactgtcatacagtgcaggaggggacggc
tccctggagaatgtgaccaccttacctaatatccttcgggagtttaacagaaacctcaca
ggctacgccgtgggcacgggtgacgccaatgacacgaatgcattcctcaatcaagctgtt
cctggagcaaaggctgaggatcttataagccaagtccaaactctggtgcagaagatgaaa
gatgatcatagagtaaatttccatgaagactggaaggtcatcacagtgctgattggaggc
agcgatttatgtgactactgcacggattcgaatctgtattctgcagccaactttgttgac
catctccgcaatgccttggacgtcctgcatggagaggtgcccagagtcctggtcaacctc
gtggacttcctgaaccccagtgtcatgcggcaggtgttcctgggaaacccggacaagtgc
ccagtgcagcaggccagcgttttgtgtaactgcgttctgaccctgcgggagaactcccaa
gagctagccaggctggaggccttcagccgagcctaccagagcagcatgcgcgagctggtg
gagtcaggccgctatgacacgcgggaggacttctctgtggtgctgcagcccttcttccag
aacatccagctccctgtcctggcggatgggctcccagatacgtccttcttcgccccagac
tgcatccacccaaatcagaaattccactcccagctggccagagccctttggaccaatatg
cttgaaccacttggaagcaaaacagagaccctggacntgagagcagagatgcccatcacc
tgtcccactcagaatgagcccttcctgagaacccctcggaacagtaactacacgtacccc
accaagccagccattgagaactggggcagtgacttcctgtgtacggagtggaaggcttcc
aatagcgttccaacctctgtccaccagctccgaccagcagacatcaaagtggtggccgcc
ctgggtgactctctgactacagcagtgggagctcgaccaaacaactccagtgacctaccc
acatcttggaggggactctcttggagcatcggaggggatgggaacttggagactcacacc
acgctgcccaacattctgaagaagttcaacccttacctccttggcttctctaccagcacc
tggaaggggacagcaggactaaatgtggcagcggaaggggccagagctagggacatgcca
gcccaggcccgggacctggtagagcgaatgaaaaacagccccgacatcaacctggaaaaa
gactggaagctggtcacactcttcattgggggcaacgacttgtgtcattactgtgagaat
ccggaggcccacttggccacggagtatgttcagcacatcgaacaggccctggacatcctc
tctgaggagctcccaagggctttcgtcaacttggtggaggtcatggaactggccagcctg
taccagggccaaggcgggaaatgtgccatgctggcagctcagaacaactgcacttgcctc
agacactcgcaaagctccctggagaagcaagaactgaagaaagtgaactggaacctccag
aatggcatctccagtttctcctactggcaccaatacacacagcgtgaggactttgcagtt
gtggtgcagcctttcttccaaaacacactcaccccactgaacgagagaggggacactgac
ctcaccttcttctctgaggactgttttcacttctcagaccgtgggcatgccgagatggcc
atcgcactctggaacaacatgctggaaccagtgggccgcaagactacctccaacaacttc
acccacagccgagccaaactcaagtgcccctctcctgagagcccttacctctacaccctg
cggaatagccgactgctcccagaccaggctgaagaagcccccgaggtgctctactgggct
gtgccagtggcggcgggagtcggccttgtggtgggcgtcatcgggacagtggtctggagg
tgcaggagaggtggccggagggaagatcctccaatgaacctgcgcactgtggccctctag

DBGET integrated database retrieval system