KEGG   Pongo abelii (Sumatran orangutan): 100460247Help
Entry
100460247         CDS       T01416                                 

Gene name
OTUD5
Definition
OTU domain containing 5
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100460247 (OTUD5)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100460247 (OTUD5)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100460247 (OTUD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 615 aa AA seqDB search
MPRVTACLNQSQQNSGCCRGEAVSASPGRVFAGPTQLLNWLVFAIVVAAAAILPTYFRAR
GGAVPWRACAALRGPTRXXXGGGESVGGNGTGVGGVDRDRDSGVVGARPRASPPPQGPLP
GPPGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGVGAAGVVVG
XGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYNSEDEYEAAAARIEAMD
PATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLM
KNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGI
HQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLMKNAIKTSEESWI
EQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPSQPRKASATCSSA
TAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPGTVLALAKPPSPCAPGTSS
QFSAGADRATSPLVSLYPALECRALIQQMSPSAFAGLNDWDDDEILASVLAVSQQEYLDS
MKKNKVHRDPPPDKS
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgagtgacggcgtgtcttaaccaatcacagcagaactcaggctgttgccggggc
gaagcggtgtccgcctcccccggaagggtatttgcaggacccacgcagctgctcaattgg
ttggtgtttgcaattgttgtggcggcggcggcgattttgcccacgtacttccgtgcaagg
ggcggggctgtgccctggcgcgcgtgcgcagcgctccggggccccacccgnnnnnnnnnc
ggcgggggagagagcgtgggcggcaacggcacgggcgtgggcggcgtcgatcgcgaccgt
gactccggcgtcgtgggggcccgtccgcgagcttcgccaccgcctcaaggcccgctacca
ggaccgccgggcgctcttcatcgctgggcgctggccgtgccgcctggtgcagtggcgggt
ccccggccccaacaggcttctccacctccttgcgggggcccaggtggtcccggcggcggt
cccggcgacgcgctgggcgcagcggcggcgggagtgggtgccgcgggcgtggtggtggga
nctgggggtgccgtaggcgtgggcggatgctgctccgggcctgggcacagcaagcggcga
cgtcaagctcctggggttggcgcggttggcgggggcagtcccgagcgtgaggaggtcggc
gcaggctacaacagtgaggacgagtatgaggcggctgcagcacgcatcgaggctatggac
cctgccactgtcgagcagcaggagcattggtttgaaaaggccctacgagacaagaagggc
ttcatcatcaagcagatgaaggaggatggtgcctgtctcttccgggctgtagctgaccag
gtgtatggagaccaggacatgcatgaggttgtgcgaaagcattgcatggactatctgatg
aagaatgccgactacttctccaactatgtcacagaggactttaccacctacattaacagg
aagcggaaaaacaattgccatggcaaccacattgagatgcaggccatggcagagatgtac
aaccgtcctgtggaggtgtaccagtacagcacagaacccatcaacacattccatgggata
catcaaaacgaggatgaacccattcgtgttagctaccatcggaatatccactataattca
gtggtgaatcctaacaaggccaccattggtgtggggctgggcctgccatcattcaaacca
gggtttgcagagcagtctctgatgaagaatgccataaaaacatcggaggagtcatggatc
gaacagcagatgctagaagacaagaaacgggccacggactgggaggccacaaatgaggcc
atcgaggagcaggtggctcgggaatcctacctgcagtggttgcgggatcaggagaaacaa
gctcgccaggtccgaggccccagccagccccggaaagccagcgccacatgcagttcggcc
acagcagcagcctccagtggcctggaggagtggactagccggtctccgcggcagcggagt
tcagcctcgtcacctgagcaccctgagctgcatgctgaattgggcatgaagcccccttcc
ccaggcactgttttagctcttgccaaacctccttcgccctgtgcgccaggtacaagcagt
cagttctcggcaggggccgaccgggcaacttccccccttgtgtccctctaccctgctttg
gagtgccgggccctcattcagcagatgtccccctctgcctttgcaggtctgaatgactgg
gatgatgatgagatcctagcgtcggtgctggcagtgtcccaacaggaatacctagacagt
atgaagaaaaacaaagtgcacagagacccgcccccagacaagagttga

DBGET integrated database retrieval system