KEGG   Pongo abelii (Sumatran orangutan): 100460599Help
Entry
100460599         CDS       T01416                                 

Gene name
UGT2B17
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide B17
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100460599 (UGT2B17)
   00053 Ascorbate and aldarate metabolism
    100460599 (UGT2B17)
   00500 Starch and sucrose metabolism
    100460599 (UGT2B17)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100460599 (UGT2B17)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100460599 (UGT2B17)
   00860 Porphyrin and chlorophyll metabolism
    100460599 (UGT2B17)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100460599 (UGT2B17)
   00982 Drug metabolism - cytochrome P450
    100460599 (UGT2B17)
   00983 Drug metabolism - other enzymes
    100460599 (UGT2B17)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100460599 (UGT2B17)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100460599 (UGT2B17)
Glycosyltransferases [BR:pon01003]
 Others
  Hydrophobic molecule
   100460599 (UGT2B17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 491 aa AA seqDB search
MSLKWTSVFLLTQLSFYFSSGSCGKVLVWPTEYSHWINMKTILEELVQKGHEVTVLTSSA
SILVNASKSSAIKFEVYPTSLTKNDLEDSLLKMLDRWTYSISKNTFWSYFSQLQEMCWEY
TDYSKKLCKDAVLNKKLMRKLQESKFDVLLADAINPCGELLAELFNIPFLYSLRFSVGYI
VEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEV
LGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAEPLIFSLPXQVLWR
FDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFAD
QHDNIAHMKAKGAALSVDIRTMSSRDLLKALKSVINDPIYKENAMKLSMIHHDQPVKPLD
RAVFWIEFVMRHKGAKHLRVAAHDLTWIQYHSLDVIAFLLACVATVIFIITKCFLFCFRK
LAKTGKKKKRD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatggacgtcagtctttctgctgacacagctcagtttttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaatacagccattggataaatatgaag
acaatcctggaagagcttgttcagaaaggtcatgaggtgactgtgttgacatcttcggct
tctattcttgtcaatgccagtaaatcatctgctattaagtttgaagtttatcctacatct
ttaactaaaaatgatttggaagattctcttctgaaaatgctggatagatggacatatagt
atttcaaaaaatacattttggtcatatttttcacaactacaagaaatgtgttgggaatat
actgactatagtaaaaagctctgtaaagatgcagttttgaacaagaaacttatgagaaaa
ctacaagagtcaaaatttgatgtccttctggcagacgccattaatccctgtggtgagctg
ctggctgagctatttaacataccctttctgtacagtctccgcttctctgttggctacata
gttgagaagaatggtggaggatttctgttccctccttcctacgtacctgttgttatgtca
gaattaagtgatcaaatgattttcatggagaggataaaaaatatgatatatatgctttat
tttgacttttggtttcaagcatatgatctgaagaagtgggaccagttttatagtgaagtt
ctaggaagacccactacattatttgagacaatggggaaagccgaaatgtggctcattcga
acctattgggattttgaatttcctcgcccattcttaccaaatgttgattttgttggagga
cttcactgtaaaccagctgaaccattgatattttccttgccctaacaggttctatggaga
tttgatggcaagaagccaaatactttaggttccaatacacgactgtacaagtggttaccc
cagaatgaccttcttggtcatcccaaaaccaaagcttttataactcatggtggaaccaat
ggcatctatgaggcgatctaccatggaatccctatggtgggcattcccttgtttgcggat
caacatgataacattgctcacatgaaagccaagggagcagccctcagtgtggacatcagg
accatgtcaagtagagatttgctcaaggcactgaagtcagtcattaatgaccctatctat
aaagagaatgctatgaaattatcaatgattcatcatgatcaacccgtgaagcccctggat
cgagcagtcttctggattgaatttgtcatgcgccacaaaggagccaagcaccttcgggtc
gcagcccacgacctcacctggatccagtaccactctttggatgtgatagcattcctgctg
gcctgcgtggcaactgtgatatttatcatcacaaaatgtttcctgttttgtttccgaaag
cttgccaaaacaggaaagaagaagaaaagggattag

DBGET integrated database retrieval system