KEGG   Pongo abelii (Sumatran orangutan): 100460796Help
Entry
100460796         CDS       T01416                                 

Gene name
DYRK4
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100460796 (DYRK4)
Protein kinases [BR:pon01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100460796 (DYRK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 548 aa AA seqDB search
MVSFPHISKKVLLKSSLLYQVKNQAHNQMPASELKASEIPFHPSIKTQDPKAEEKSPKKH
KVPLTAAEALKLFKNQLSLYEQSEILGYAELWFLGLEAKKLDMAPEKLSKTSFDDEHGSY
LKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKIL
EALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTL
SVLKCLQMLSVEKIIHCDLKPENIVLYQKGQVSVKVIDFGSSCYEHQKVYTYIQSRFYRS
PEVILGHPYDMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQMAS
RRQTFFDSKGFPKNITNNRGNKRYPDSKDLTMVLKTYDSSFLDFLRRCLVWEPSLRMTPD
QALKHAWIHQSQNLKPQPRPQTLRKSNSFFSSETRKNKVQGCHHSRKKADEITKETTEKT
KDGPMKHVQHSGDQQDSLQLGADTVQLPQLVEAPKKSEAAVGAEVSVTSPGQSKNFSLKN
TNILPPIV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcttcccacacattagtaagaaagtcctgctgaagtcatccctgctgtatcag
gtgaagaatcaagctcacaatcagatgccggcctcagagctcaaggcttcagaaatacct
ttccaccctagcattaaaacccaggatcccaaggcagaggagaagtcaccaaagaagcac
aaggtgcctctgacagccgcagaggccctaaagctttttaagaaccagctgtctctatac
gagcaaagtgaaatcctgggctacgcggagctgtggttcctggggcttgaagccaagaag
ctcgacatggctcctgagaaattgagcaagacgagttttgatgatgagcatggctcctat
ctgaaggtcctgcatgatcacattgcctaccgctatgaagttctggagatgatcgggaag
gggtcctttggacaggtggccaagtgcttggatcacaaaaacaatgagctggtggccctg
aaaatcatcaggaacaagaagagatttcaccagcaggccctgatggagctgaagatcctg
gaagctctcagaaagaaggacaaagacaacacctacaatgtggtgcatatgaaggacttt
ttctactttcgcaatcacttctgcatcacctttgagctcctgggaatcaacttgtatgag
ttgatgaagaataacaactttcaaggcttcagtctgtcgatagttcggcgcttcactctc
tctgttttgaagtgcttgcaaatgctttctgtagagaaaatcatccactgcgatctcaag
cccgaaaatatagtgctataccaaaagggccaagtctctgttaaagtcattgactttgga
tcaagctgttatgaacaccagaaagtatacacgtacatccaaagccggttctaccgatcc
ccagaagtgatcctgggccacccctacgacatggccattgacatgtggagcctggggtgc
atcatggcagagttgtacacgggctaccccctgtttcctggggagaatgaggtggagcag
ctggcctgcatcatggaggtgctgggtctgccaccagctggcttcattcagatggcctcc
aggagacagacattctttgattccaaaggttttcctaaaaatataaccaacaacaggggg
aacaaaagatacccagattccaaggacctcacgatggtgctgaaaacctatgacagcagc
ttcctggactttctcagaaggtgtttggtatgggaaccttctcttcgcatgaccccggac
caggccctcaagcatgcttggattcatcagtctcagaacctcaagccacagcccaggccc
cagaccctaaggaaatccaattcctttttctcctctgagacaaggaagaacaaggttcaa
ggctgtcatcactcgaggaaaaaagcagatgagatcaccaaagagactacagagaaaaca
aaagatggccccatgaagcatgttcagcattcaggtgatcagcaggactctctccagctc
ggagctgacactgttcagctgcctcaactggtagaagctcccaagaagtcagaggcagct
gttggggcggaggtgtccgtgacctccccaggacaaagcaaaaacttctccctcaagaac
acaaacattttaccccctattgtatga

DBGET integrated database retrieval system