KEGG   Pongo abelii (Sumatran orangutan): 100460832Help
Entry
100460832         CDS       T01416                                 

Definition
carboxylesterase 5A-like
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100460832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 506 aa AA seqDB search
MAVLICPPPCHGLKEFRIRRGMWRLCLVHYFYLASSTLYVLRIDVLNYSSKDEGPSAEGP
QRNTSLGWIQGKQVTVLGSPVPVNVFLGVPFAAPPLGSLRFTNPQPASPWDNLQEATSYP
NLCLQNSEWLLLDQHMLKVHYPKFGVSEDCLYLNIYAPAHANAGSKLPVLVWFPGGAFKT
GSASTFDGSTLAAYEDVLVVVVQYWLGIFGFFTTWDQHALGNWAFKDQVAALSWVQKNIE
FFGGDPSSVTIFGESAGAISVSSLVLSPMAKGLFHKAIMETGVAIIPYLKAHDYEKSEDL
QVVAHFCGNNASDSEALLRCLRTKSSKELLTLSQVRTEGASFTRVVDGDFFPNEPLDLLS
QKAFKAIPSIIGVNNHECGFLLPMKEAPEILSGSNKSLALHLIQNILHIPPQYLHLVANE
YFHNKHSLTEIRDSLLDLLGDVFFVVPALITARYHRDAGAPVYFYEFRHRPQCFEDTKPA
FVKADHADEVRFVFGGAFLKGDIVMF
NT seq 1519 nt NT seq  +upstreamnt  +downstreamnt
atggctgttctgatttgccctcctccatgccatggcctaaaggagtttaggataagaagg
ggaatgtggagattgtgcctagttcactatttttatctagcctcctcaactttgtatgta
ttgaggattgatgtcttaaattacagttccaaagatgaggggccttctgctgaagggcca
cagaggaacaccagtctgggatggattcagggcaagcaagtcacggtgctgggaagccct
gtgcctgtgaatgtgttcctcggagtcccctttgctgctcccccgctgggatccctgcga
tttacgaacccgcagcctgcatcgccctgggataacttgcaagaagccacctcctaccct
aatttgtgcctccagaactcagagtggctgctcttagatcaacacatgctcaaggtgcat
taccccaaattcggagtgtcagaagactgcctctacctgaacatctatgcccctgcccac
gccaatgcaggctccaagctccccgtcttggtgtggttcccagggggtgccttcaagact
ggctcagcctccacctttgatgggtccaccctggctgcctatgaggacgtgctggttgtg
gtcgtccagtactggctgggaatatttggtttcttcaccacatgggatcagcacgctctg
gggaactgggccttcaaggaccaggtagctgctctgtcctgggtccagaagaacatcgag
ttcttcggtggggaccccagctctgtgaccatctttggcgagtctgcaggagccataagt
gtttctagtcttgtactgtctcccatggccaaaggcttattccacaaagccatcatggag
actggggtggccatcatcccttacctgaaggcccatgattatgagaagagtgaggatctg
caagtggttgcacatttctgtggtaacaatgcatcagactctgaggccctgctgaggtgc
ctgaggacaaaatcctccaaggagctgctgaccctcagccaggtgaggacagagggggca
tctttcactcgagtggttgatggtgatttctttcctaatgagcctctagatctattgtct
cagaaagcatttaaagcaattccttccatcatcggagtcaataaccacgagtgtggcttc
ctgctgcctatgaaggaggctcctgagatcctcagtggctccaacaagtcccttgccctc
catctgatacaaaacatcctgcacatcccgcctcagtatttgcaccttgtggctaatgaa
tacttccataacaagcactccctgactgaaatccgagacagtcttctggacttgcttgga
gatgtgttctttgtggtccctgcactgatcacagctcgatatcacagagatgctggtgca
cctgtctacttctatgagtttcggcaccggcctcagtgctttgaagacacgaagccagct
tttgtcaaagccgaccacgctgatgaagtccgctttgtgttcggtggtgccttcctgaag
ggtgacattgttatgttcg

DBGET integrated database retrieval system