KEGG   Pongo abelii (Sumatran orangutan): 100460912Help
Entry
100460912         CDS       T01416                                 

Gene name
POLD4
Definition
polymerase (DNA-directed), delta 4, accessory subunit
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100460912 (POLD4)
   00240 Pyrimidine metabolism
    100460912 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100460912 (POLD4)
   03410 Base excision repair
    100460912 (POLD4)
   03420 Nucleotide excision repair
    100460912 (POLD4)
   03430 Mismatch repair
    100460912 (POLD4)
   03440 Homologous recombination
    100460912 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100460912 (POLD4)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100460912 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 107 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGP
CTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgattcctacccggttgtgaagaggagggaggggccc
gctgggcacagcaagggggagctggcacccgagctaggggaggagccccagccccgcgac
gaggaggaagcggagctggagctgctgaggcagtttgacctggcctggcagtacgggccc
tgcaccgggatcacacggctgcagcgctggtgtcgggccaagcagatgggcttggagcct
cccccagaggtgtggcaggtgctgaagacccaccccggagacccccgcttccagtgcagt
ctctggcatctctatcccctatga

DBGET integrated database retrieval system