KEGG   Pongo abelii (Sumatran orangutan): 100461146Help
Entry
100461146         CDS       T01416                                 

Gene name
PPP3R2
Definition
protein phosphatase 3, regulatory subunit B, beta
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100461146 (PPP3R2)
   04310 Wnt signaling pathway
    100461146 (PPP3R2)
   04370 VEGF signaling pathway
    100461146 (PPP3R2)
   04020 Calcium signaling pathway
    100461146 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    100461146 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100461146 (PPP3R2)
   04210 Apoptosis
    100461146 (PPP3R2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100461146 (PPP3R2)
   04660 T cell receptor signaling pathway
    100461146 (PPP3R2)
   04662 B cell receptor signaling pathway
    100461146 (PPP3R2)
  Endocrine system
   04921 Oxytocin signaling pathway
    100461146 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    100461146 (PPP3R2)
   04720 Long-term potentiation
    100461146 (PPP3R2)
  Development
   04360 Axon guidance
    100461146 (PPP3R2)
   04380 Osteoclast differentiation
    100461146 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100461146 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    100461146 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    100461146 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    100461146 (PPP3R2)
   05166 HTLV-I infection
    100461146 (PPP3R2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100461146 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 130 aa AA seqDB search
MVPARSWRPQPVGAEKVIDVFDTDGDGEVDFKEFILGTSQFSVNGDEEQKLRFAFSIYDM
DKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLE
IPQESWSSFV
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggtccctgcccggagctggcgtccacaacccgttggtgcggagaaggtgatcgacgtc
ttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctggggacctcccag
ttcagcgtcaacggcgacgaggagcagaagttgagatttgcgttcagcatttacgacatg
gataaagatggctatatttccaacggggagctcttccaggtgctgaagatgatggtgggc
aacaacctgacggactggcagctccagcagctggtcgacaaaaccatcatcatcctggac
aaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtcagagacctggag
attccacaagaaagctggtcctcattcgtgtga

DBGET integrated database retrieval system