KEGG   Pongo abelii (Sumatran orangutan): 100461354Help
Entry
100461354         CDS       T01416                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:pon00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 495 aa AA seqDB search
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLVLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAH
KKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQAGTPVAIEEEFSLLTCSIICYLTFGD
KIKEDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIERRDHIVEK
QLRQHKESLVAGQWRDMMDYMLQGVAQPSVEEGSGQLLEGHVHMAAVDLLIGGTETTANT
LSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVV
PLALPHRTTRPSSISGYDIPEGTVIIPKLQGAHLDETVWERPHEFWPDRFLEPGKNSRAL
AFGCRARVCLGEPLARLELFVVLTRLLQAFTLLPPGDALPSLQPLPHCSVILKMQPFQVR
LQPRGMGAHSPGQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgggcctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aactggtggaagctccggagcctccacctcccgcctcttgccccgggcttcttgcacctg
ctgcagcccgacctccccatctatctgctcgtcttgactcagaaattcgggcccatctac
aggctccaccttgggcttcaagatgtggtggtgctgaactccaaaaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaagaactacccagacctgtccttgggagactactccctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatccgtgactccatggagccagtggtg
gagcagctgacccaggagttctgcgagcgcatgagagcccaggccggcacccctgtggcc
attgaggaggaattctctctcctcacctgtagcatcatctgttacctcaccttcggagac
aagatcaaggaggacaacttaatgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggatgtgattccctttctcaggttcttcccc
aatccaggtctccggaggctgaagcaggccatagagaggagggaccacatcgtggagaag
cagctgaggcagcacaaggagagcctggtggcaggccagtggagggacatgatggactac
atgctccaaggggtggcgcagccgagcgtggaagagggctctggacagctcctggaaggg
cacgtgcacatggctgcagtggacctcctgatcggtggcactgagaccacggcaaacacc
ctctcctgggccgtggtttttttgcttcaccaccctgagattcagcagcgactgcaggag
gagctagaccacgaactgggccctggtgcctccagctcccgggtcccctacaaggaccgt
gcacggctgcccttgctcaatgccaccatcgccgaggtgctgcgcctgcggcccgttgtg
cccttagccttgccccaccgcaccacacggcccagcagcatctccggctacgacatccct
gagggcacagtcatcatcccgaaacttcagggcgcccacctggatgagacggtctgggag
aggccacatgagttctggcctgatcgcttcctggagccaggcaagaactccagagctctg
gccttcggctgcagggcccgtgtgtgcctgggcgagccgctggcgcgcctggagctcttc
gtggtgctgacccgactgctgcaggccttcacgctgctgccccccggggacgccctgccc
tccctgcagcccctgccccactgcagtgtcatcctcaagatgcagcctttccaagtgcgg
ctgcagccccgggggatgggggcccacagcccgggccagagccagtga

DBGET integrated database retrieval system