KEGG   Pongo abelii (Sumatran orangutan): 100461354Help
Entry
100461354         CDS       T01416                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100461354
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    100461354
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100461354
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP21 family
   100461354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 495 aa AA seqDB search
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLVLTQKFGPIY
RLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAH
KKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQAGTPVAIEEEFSLLTCSIICYLTFGD
KIKEDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIERRDHIVEK
QLRQHKESLVAGQWRDMMDYMLQGVAQPSVEEGSGQLLEGHVHMAAVDLLIGGTETTANT
LSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVV
PLALPHRTTRPSSISGYDIPEGTVIIPKLQGAHLDETVWERPHEFWPDRFLEPGKNSRAL
AFGCRARVCLGEPLARLELFVVLTRLLQAFTLLPPGDALPSLQPLPHCSVILKMQPFQVR
LQPRGMGAHSPGQSQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcctgggcctgctgctgctgctgcccctgctggctggcgcccgcctgctgtgg
aactggtggaagctccggagcctccacctcccgcctcttgccccgggcttcttgcacctg
ctgcagcccgacctccccatctatctgctcgtcttgactcagaaattcgggcccatctac
aggctccaccttgggcttcaagatgtggtggtgctgaactccaaaaggaccattgaggaa
gccatggtcaaaaagtgggcagactttgctggcagacctgagccacttacctacaagctg
gtgtctaagaactacccagacctgtccttgggagactactccctgctctggaaagcccac
aagaagctcacccgctcagccctgctgctgggcatccgtgactccatggagccagtggtg
gagcagctgacccaggagttctgcgagcgcatgagagcccaggccggcacccctgtggcc
attgaggaggaattctctctcctcacctgtagcatcatctgttacctcaccttcggagac
aagatcaaggaggacaacttaatgcctgcctattacaaatgtatccaggaggtgttaaaa
acctggagccactggtccatccaaattgtggatgtgattccctttctcaggttcttcccc
aatccaggtctccggaggctgaagcaggccatagagaggagggaccacatcgtggagaag
cagctgaggcagcacaaggagagcctggtggcaggccagtggagggacatgatggactac
atgctccaaggggtggcgcagccgagcgtggaagagggctctggacagctcctggaaggg
cacgtgcacatggctgcagtggacctcctgatcggtggcactgagaccacggcaaacacc
ctctcctgggccgtggtttttttgcttcaccaccctgagattcagcagcgactgcaggag
gagctagaccacgaactgggccctggtgcctccagctcccgggtcccctacaaggaccgt
gcacggctgcccttgctcaatgccaccatcgccgaggtgctgcgcctgcggcccgttgtg
cccttagccttgccccaccgcaccacacggcccagcagcatctccggctacgacatccct
gagggcacagtcatcatcccgaaacttcagggcgcccacctggatgagacggtctgggag
aggccacatgagttctggcctgatcgcttcctggagccaggcaagaactccagagctctg
gccttcggctgcagggcccgtgtgtgcctgggcgagccgctggcgcgcctggagctcttc
gtggtgctgacccgactgctgcaggccttcacgctgctgccccccggggacgccctgccc
tccctgcagcccctgccccactgcagtgtcatcctcaagatgcagcctttccaagtgcgg
ctgcagccccgggggatgggggcccacagcccgggccagagccagtga

DBGET integrated database retrieval system