KEGG   Pongo abelii (Sumatran orangutan): 100461514Help
Entry
100461514         CDS       T01416                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100461514 (DBH)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100461514 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 617 aa AA seqDB search
MPALSRWASLPGPSVREAAFMYSTAVAVFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDSQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQTGLQRVQLLKPNIPEPELPPDTYTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTEGNEALVHHMEVFQCAPEMDNVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRKDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFDLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHQGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQRYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GQSPAGPTIVSIGGGKG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccctcagtcgctgggccagcctgcccggccccagcgtgcgggaggcagcgttc
atgtacagcacagcagtggccgtcttcctggtcatcctggtggccgcactgcagggttcg
gctccccgtgagagccccctcccgtatcacatccccctggaccccgaggggtccctggag
ctctcatggaatgtcagctacacccaggaggccatccacttccagctcctggtgcggagg
ctcaaggctggggtcctgtttgggatgtccgaccgtggcgagcttgagaatgcggacctc
gtggtgctctggaccgatggggacactgcctattttgcggacgcctggagtgaccagaag
gggcagatccacctggattcccagcaggactaccagctgctgcaggtgcagaggacccca
gaaggcctgaccctgcttttcaagaggccctttggcacctgtgaccccaaggattacctc
attgaggacggcactgtccacttggtctacgggatcctggaggagccgttccggtcactg
gaggccatcaacggctcaggcctgcagacggggctgcagagggtgcagctcctgaagccc
aatatccccgaaccggagttgcccccagacacgtacaccatggaggtccaagctcccaat
atccagatccccagccaggagaccacatactggtgctacattaaggagcttccaaagggc
ttttctcggcaccacattatcaagtacgagcccatcgtcaccgagggcaacgaggccctc
gtgcaccacatggaagtcttccagtgcgcccccgagatggacaacgtcccccacttcagc
gggccctgcgactccaagatgaaacccgaccgcctcaactactgccgccacgtgctggcc
gcctgggccctgggcgccaaggcattttactacccagaggaagccggccttgccttcggg
ggccctgggtcctccagatatctccgcctggaagttcactaccacaacccgctggtgata
gaaggacgaaaagactcctcaggcatccgcttgtactacacagccaagctgcggcgcttc
aacgcggggatcatggagctgggactggtgtacacaccagtgatggccattccaccacgg
gagaccgcctttgacctcactggctactgcacggacaagtgcacccagctggcactgcct
ccctccgggattcacatcttcgcctctcagctccacacacacctgaccgggagaaaggtg
gtcacagtgctagtccgggacggccgggagtgggagatcgtgaaccaggacaatcactac
agccctcacttccaggagatccgcatgttgaagaaggtcgtgtcagtccatcagggagat
gtgctcatcacgtcctgcacgtacaacacggaagaccgggagctggccacagtggggggc
tttgggatcctggaggagatgtgtgtcaactacgtgcactactacccccagacgcagctg
gagctctgcaagagcgctgtggacgccggcttcctgcagaggtacttccacctcatcaac
aggttcaacaatgaggacgtctgcacctgccctcaggcgtccgtgtctcagcagttcacc
tccgttccctggaactccttcaaccgcgacgtactgaaggccctgtacagcttcgcgccc
atctccatgcactgcaacaagtcctcagccgtccgtttccagggtgaatggaacctgcag
cccctgcccaaggtcatctccacactggaagagcccactccacagtgccccaccagccag
ggccaaagccctgccggccccaccattgtcagcattggtgggggcaaaggctga

DBGET integrated database retrieval system