KEGG   Pongo abelii (Sumatran orangutan): 100461514Help
Entry
100461514         CDS       T01416                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pon00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 617 aa AA seqDB search
MPALSRWASLPGPSVREAAFMYSTAVAVFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDSQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQTGLQRVQLLKPNIPEPELPPDTYTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTEGNEALVHHMEVFQCAPEMDNVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRKDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFDLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHQGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQRYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GQSPAGPTIVSIGGGKG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccctcagtcgctgggccagcctgcccggccccagcgtgcgggaggcagcgttc
atgtacagcacagcagtggccgtcttcctggtcatcctggtggccgcactgcagggttcg
gctccccgtgagagccccctcccgtatcacatccccctggaccccgaggggtccctggag
ctctcatggaatgtcagctacacccaggaggccatccacttccagctcctggtgcggagg
ctcaaggctggggtcctgtttgggatgtccgaccgtggcgagcttgagaatgcggacctc
gtggtgctctggaccgatggggacactgcctattttgcggacgcctggagtgaccagaag
gggcagatccacctggattcccagcaggactaccagctgctgcaggtgcagaggacccca
gaaggcctgaccctgcttttcaagaggccctttggcacctgtgaccccaaggattacctc
attgaggacggcactgtccacttggtctacgggatcctggaggagccgttccggtcactg
gaggccatcaacggctcaggcctgcagacggggctgcagagggtgcagctcctgaagccc
aatatccccgaaccggagttgcccccagacacgtacaccatggaggtccaagctcccaat
atccagatccccagccaggagaccacatactggtgctacattaaggagcttccaaagggc
ttttctcggcaccacattatcaagtacgagcccatcgtcaccgagggcaacgaggccctc
gtgcaccacatggaagtcttccagtgcgcccccgagatggacaacgtcccccacttcagc
gggccctgcgactccaagatgaaacccgaccgcctcaactactgccgccacgtgctggcc
gcctgggccctgggcgccaaggcattttactacccagaggaagccggccttgccttcggg
ggccctgggtcctccagatatctccgcctggaagttcactaccacaacccgctggtgata
gaaggacgaaaagactcctcaggcatccgcttgtactacacagccaagctgcggcgcttc
aacgcggggatcatggagctgggactggtgtacacaccagtgatggccattccaccacgg
gagaccgcctttgacctcactggctactgcacggacaagtgcacccagctggcactgcct
ccctccgggattcacatcttcgcctctcagctccacacacacctgaccgggagaaaggtg
gtcacagtgctagtccgggacggccgggagtgggagatcgtgaaccaggacaatcactac
agccctcacttccaggagatccgcatgttgaagaaggtcgtgtcagtccatcagggagat
gtgctcatcacgtcctgcacgtacaacacggaagaccgggagctggccacagtggggggc
tttgggatcctggaggagatgtgtgtcaactacgtgcactactacccccagacgcagctg
gagctctgcaagagcgctgtggacgccggcttcctgcagaggtacttccacctcatcaac
aggttcaacaatgaggacgtctgcacctgccctcaggcgtccgtgtctcagcagttcacc
tccgttccctggaactccttcaaccgcgacgtactgaaggccctgtacagcttcgcgccc
atctccatgcactgcaacaagtcctcagccgtccgtttccagggtgaatggaacctgcag
cccctgcccaaggtcatctccacactggaagagcccactccacagtgccccaccagccag
ggccaaagccctgccggccccaccattgtcagcattggtgggggcaaaggctga

DBGET integrated database retrieval system