KEGG   Pongo abelii (Sumatran orangutan): 100461675Help
Entry
100461675         CDS       T01416                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100461675 (RASGRF1)
   04010 MAPK signaling pathway
    100461675 (RASGRF1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100461675 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 682 aa AA seqDB search
MMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYA
SVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLE
LLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALD
LAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDMTPEKPEDPSALSK
QSSEVSMREESDVDQNQSDDGDTETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCR
ELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAAT
NRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQED
PGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLE
KNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSTIEKWVAVADICRCLHNYNAVLE
ITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLG
MYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQ
SFVMDEESLYESSLRIEPKLPT
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgcatttgaagaaaattccaaggtcactgtgccacagatgatcaagaggacc
agggaggggaccagggaagcagaaatgagcaggtccgatgcctccttatattgtgatgat
gttgacattcgcttcagcaaaaccatgaactcctgcaaagtgctgcagatccgctatgcc
agtgtggagcggctgctggagaggctgacggacctgcgcttcctgagcatcgacttcctc
aacaccttcctgcactcctaccgtgtcttcaccaccgccatcgtggtcctggacaagctt
attaccatctataagaagcctatcagtgccatccctgccaggtggctgaggtcgctggag
ctcctgtttgccagtggccagaacaataagcttctgtacggtgaaccccccaagtcgccg
cgcgccacccgcaagttctcctcgccaccacctctgtccatcaccaagacatcgtcaccg
agccgccggcggaagctctccctgaacatccccatcatcaccggcggcaaggccctggac
ctggccgccctcagctgcaactccaatggctacaccagcatgtactcggccatgtcgccc
ttcagcaaggccacgctggacaccagcaagctctatgtgtccagcagcttcaccaacaag
attccagatgagggtgacatgacccctgagaagcccgaagacccttcggcgctcagcaag
cagagctcagaagtctccatgagagaggagtcagatgttgatcaaaaccagagtgatgat
ggtgatactgaaacatcaccaactaaatctccaacaacacccaaatcagtcaaaagcaaa
aattcttcagagttcccactcttttcctataacaatggagtcgtcatgacctcctgtcgc
gagctggacaataaccgcagtgccttgtcggctgcctccgcctttgccatagcaaccgcg
ggggccaacgagggcaccccaaacaaggagaagtaccggaggatgtccttagccagtgca
gggtttcccccagaccagaggaacggagacaaggagtttgtgatccgcagagcagccacc
aatcgtgtcttgaacgtgctccgccactgggtgtccaagcactctcaggactttgagacc
aatgatgagctcaaatgcaaggtgatcggcttcctggaagaagtcatgcacgacccagag
ctcctgacccaggagcggaaggctgcagccaacatcatcaggactctgacccaggaggac
ccaggtgacaaccagatcacgctggaggagatcacgcagatggctgaaggcgtgaaggct
gagccctttgaaaaccactcggccctggagatcgcggagcagctgaccctactagaccac
ctcgtcttcaagaagattccttatgaggagttcttcggacaaggatggatgaaactggaa
aagaatgaaaggaccccttatatcatgaaaaccactaagcacttcaatgacatcagtaac
ttgattgcttcagaaatcatccgcaatgaggacatcaacgccagggtgagcaccattgag
aagtgggtggccgtggctgacatatgccgctgcctccacaactacaatgccgtgctggag
atcacctcgtccatgaaccgcagtgcaatcttccggctcaaaaagacgtggctcaaagtc
tctaagcagactaaagctttgattgataagctccaaaagcttgtgtcatctgagggcaga
tttaagaatctcagagaagctctgaaaaattgtgacccaccctgtgtcccttacctgggg
atgtacctcaccgacctggccttcatcgaggaggggacgcccaattacacggaagacggc
ctggtcaacttctccaagatgaggatgatatcccatattatccgagagattcgccagttt
caacaaactgcctacaaaatagagcaccaagcaaaggtaacgcaatatttactggaccaa
tcttttgtaatggatgaagaaagcctctacgagtcttctctccgaatagaaccaaaactc
cccacctga

DBGET integrated database retrieval system