KEGG   Pongo abelii (Sumatran orangutan): 100461675Help
Entry
100461675         CDS       T01416                                 

Gene name
RASGRF1
Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 1 isoform X3
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100461675 (RASGRF1)
   04010 MAPK signaling pathway
    100461675 (RASGRF1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100461675 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N Sec34
Motif
Other DBs
NCBI-GeneID: 100461675
NCBI-ProteinID: XP_009248362
UniProt: A0A2J8SKM9
Position
15
AA seq 489 aa AA seqDB search
MYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDMTPEKPEDPSALSKQSSEVSMREESDV
DQNQSDDGDTETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAAS
AFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSK
HSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQ
MAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTK
HFNDISNLIASEIIRNEDINARVSTIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRL
KKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGT
PNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESS
LRIEPKLPT
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtactcggccatgtcgcccttcagcaaggccacgctggacaccagcaagctctatgtg
tccagcagcttcaccaacaagattccagatgagggtgacatgacccctgagaagccggaa
gacccttcggcgctcagcaagcagagctcagaagtctccatgagagaggagtcagatgtt
gatcaaaaccagagtgatgatggtgatactgaaacatcaccaactaaatctccaacaaca
cccaaatcagtcaaaagcaaaaattcttcagagttcccactcttttcctataacaatgga
gtcgtcatgacctcctgtcgcgagctggacaataaccgcagtgccttgtcggctgcctcc
gcctttgccatagcaaccgcgggggccaacgagggcaccccaaacaaggagaagtaccgg
aggatgtccttagccagtgcagggtttcccccagaccagaggaacggagacaaggagttt
gtgatccgcagagcagccaccaatcgtgtcttgaacgtgctccgccactgggtgtccaag
cactctcaggactttgagaccaatgatgagctcaaatgcaaggtgatcggcttcctggaa
gaagtcatgcacgacccagagctcctgacccaggagcggaaggctgcagccaacatcatc
aggactctgacccaggaggacccaggtgacaaccagatcacgctggaggagatcacgcag
atggctgaaggcgtgaaggctgagccctttgaaaaccactcggccctggagatcgcggag
cagctgaccctactagaccacctcgtcttcaagaagattccttatgaggagttcttcgga
caaggatggatgaaactggaaaagaatgaaaggaccccttatatcatgaaaaccactaag
cacttcaatgacatcagtaacttgattgcttcagaaatcatccgcaatgaggacatcaac
gccagggtgagcaccattgagaagtgggtggccgtggctgacatatgccgctgcctccac
aactacaatgccgtgctggagatcacctcgtccatgaaccgcagtgcaatcttccggctc
aaaaagacgtggctcaaagtctctaagcagactaaagctttgattgataagctccaaaag
cttgtgtcatctgagggcagatttaagaatctcagagaagctctgaaaaattgtgaccca
ccctgtgtcccttacctggggatgtacctcaccgacctggccttcatcgaggaggggacg
cccaattacacggaagacggcctggtcaacttctccaagatgaggatgatatcccatatt
atccgagagattcgccagtttcaacaaactgcctacaaaatagagcaccaagcaaaggta
acgcaatatttactggaccaatcttttgtaatggatgaagaaagcctctacgagtcttct
ctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system