KEGG   Pongo abelii (Sumatran orangutan): 100461836Help
Entry
100461836         CDS       T01416                                 

Gene name
THBS4
Definition
(RefSeq) thrombospondin-4
  KO
K04659  thrombospondin 2/3/4/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon05144  Malaria
pon05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100461836 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100461836 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100461836 (THBS4)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100461836 (THBS4)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100461836 (THBS4)
   05144 Malaria
    100461836 (THBS4)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100461836 (THBS4)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100461836 (THBS4)
  Exosomal proteins of colorectal cancer cells
   100461836 (THBS4)
  Exosomal proteins of bladder cancer cells
   100461836 (THBS4)
Cell adhesion molecules and their ligands [BR:pon04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100461836 (THBS4)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     100461836 (THBS4)
   VNR
     100461836 (THBS4)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   100461836 (THBS4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100461836 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF EGF_3
Motif
Other DBs
NCBI-GeneID: 100461836
NCBI-ProteinID: XP_024103393
Ensembl: ENSPPYG00000015593
Position
5
AA seq 1002 aa AA seqDB search
MGHLRRRPGPRPRFNARPGDLQAGPTPPSPPASRGAGRANMLAPRGAAVLLLHLVLQPWL
AAGAQATPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYVISTFKLQTKSSATIFGLYSS
TDNTKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLADGRRHRILLRLSNLQRGAGS
LELYLDCIQVDSIHSLPRAFAGPSQKPETIELRTFQRKPQDFLEELKLVVRGSLFQVASL
QDCFLQQSEPLPATGTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQA
CGPLKFQSPTPSSTVVPPAPPAPPTRPPRRCDSNPCFRGVQCTDSRDGFQCGPCPEGYTG
NGITCIDVDECKYHPCYPGVRCINLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQVCTD
IDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKAERNCRNPELNPCSVNAQCI
EERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDAD
RDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFGDACDNCLSVLNNDQKDTDG
DGRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGDACDSCPDVSNPNQSDVDND
LVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPG
PDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLD
PEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFI
FGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDT
SDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGG
RLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFDN
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacctgcgccgccggcccgggccccgaccgaggttcaacgcacggcccggggac
ctccaggcggggccgacgccgccgtcgcccccggcctcgcggggagcaggaagagccaac
atgctggccccgcgcggagccgccgtcctcctgctgcacctggtcctgcagccgtggcta
gcggccggcgcccaggccaccccccaggtttttgaccttctcccatcttccagtcagagg
ctaaacccaggcgctctgctgccggtcctgacagaccccgccctgaatgatctctatgtg
atttccaccttcaagctgcagactaaaagttcagccaccatcttcggtctttactcttca
actgacaacactaaatattttgaatttactgtgatgggacgcttaaacaaagccatcctc
cgttacctgaagaacgacgggaaggtgcatttggtggttttcaacaacctgcagctggca
gacggaaggcggcacaggatcctcctgaggctgagcaatttgcagcgaggggccggctcc
ctagagctctacctggactgcatccaggtggattccattcacagtctccccagggccttt
gctggcccctcccagaaacctgagaccattgaattgaggactttccagaggaagccacag
gacttcttggaagagctgaagctggtggtgagaggctcactgttccaggtggccagcctg
caagactgcttcctgcagcagagtgagccgctgcctgccacaggcacaggggactttaac
cggcagttcttgggtcaaatgacacaattaaaccaactcctgggagaggtgaaggacctt
ctgagacagcaggttaaggaaacatcatttttgcgaaacaccatagctgaatgccaggct
tgcggtcctctcaagtttcagtctccaaccccaagcagcacagtggtgcccccggcaccc
cctgcaccgccaacacgcccacctcgtcggtgtgactccaacccatgtttccgaggtgtc
caatgtaccgacagcagagatggcttccagtgtgggccctgccccgagggctacacagga
aacgggatcacctgtattgatgttgatgagtgcaaataccatccctgctacccgggtgtg
cgctgcataaatttgtctcctggcttcagatgtgacgcctgcccagtgggcttcacaggg
cccatggtgcagggtgttgggatcagttttgccaagtcaaacaagcaggtctgcactgac
attgatgagtgtcgaaatggagcgtgcgttcccaactcgatctgcgttaatactttggga
tcttaccgctgtgggccttgtaagccagggtatactggtgatcagataaggggatgcaaa
gcggaaagaaactgcagaaacccagagctgaacccttgcagtgtgaatgcccagtgcatt
gaagagaggcagggggatgtgacatgtgtgtgtggagttggttgggctggcgatggctat
atctgtggaaaggatgtggacatcgacagttaccccgacgaagaactgccgtgctctgcc
aggaactgtaaaaaggacaactgcaagtatgtgccaaattctggccaagaagatgcagac
agagatggtattggcgacgcttgtgacgaggatgctgacggagatgggatcctgaatgag
caggataactgtgtcctgattcacaatgtggaccaaaggaacagcgataaagatatcttt
ggggatgcctgtgataactgcctgagtgtcttaaataacgaccagaaagacacggatggg
gatggaagaggagatgcctgtgatgatgacatggatggagatggaataaaaaacattctg
gacaactgcccaaaatttcccaatcgtgaccaacgggacaaggatggtgatggtgtgggg
gatgcctgtgacagttgtcctgatgtcagcaaccctaaccagtccgatgtggataatgat
ctggttggggactcctgtgacaccaatcaggacagtgatggagatggtcaccaggacagc
acagacaactgccccaccgtcattaacagtgcccagctggacaccgataaggatggaatt
ggtgacgagtgtgatgatgatgatgacaatgatggtatcccagacctggtgccccctgga
ccagacaactgccggttggtccccaacccagcccaggaggatagcaacagcgatggagtg
ggagacatctgtgagtctgactttgaccaggaccaggtcatcgatcggatcgacgtctgc
ccagagaacgcagaggtcaccctgaccgacttcagggcttaccagaccgtggtcctggat
cctgaaggggacgcccagatcgatcccaactgggtggtcctgaaccagggcatggagatt
gtgcagaccatgaacagtgatcctggcctggcagtggggtacacggcttttaatggagtt
gacttcgaagggaccttccatgtaaatacccagacagatgatgactatgcaggctttatc
tttggctaccaagacagctccagcttctacgtggtcatgtggaagcagacggagcagaca
tattggcaagccaccccattccgagcggttgcagaacctggcattcagctgaaggctgtg
aagtctaagacaggtccaggggagcatctccggaactccctgtggcacacgggggacacc
agtgaccaggtcaggctgctgtggaaggactccaggaatgtgggctggaaggacaaggtg
tcctaccgctggttcctacagcacaggccccaggtgggctacatcagggtacgattttat
gaaggctctgagttggtggctgactctggagtcaccatagacacgacaatgcgtggaggc
cgacttggcgttttctgcttctctcaagaaaacatcatctggtccaacctcaagtatcgc
tgcaatgacaccatccctgaggacttccaagagtttcaaacccagaatttcgaccgcttc
gataattaa

DBGET integrated database retrieval system