KEGG   Pongo abelii (Sumatran orangutan): 100461836Help
Entry
100461836         CDS       T01416                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100461836 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100461836 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100461836 (THBS4)
  Cellular commiunity
   04510 Focal adhesion
    100461836 (THBS4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100461836 (THBS4)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100461836 (THBS4)
  Exosomal proteins of colorectal cancer cells
   100461836 (THBS4)
  Exosomal proteins of bladder cancer cells
   100461836 (THBS4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100461836 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1006 aa AA seqDB search
MLAPRGAAVLLLHLVLQPWLAAGAQATPQGKWAPVGPGSAGHRVPHLLNSNVLLACFHST
PKSAFSVCASQPVRGCEEVSDNKEASGGDHVDIRDFPSDSSHHLCRSQNLTPTGCLQTVA
NWLSSDCGQLAVFRLWSTGKSTILRYLKNDGKVHLVVFNNLQLADGRRHRILLRLSNLQR
GAGSLELYLDCIQVDSIHSLPRAFAGPSQKPETIELRTFQRKPQDFLEELKLVVRGSLFQ
VASLQDCFLQQSEPLPATGTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIA
ECQACGPLKFQSPTPSSTVVPPAPPAPPTRPPRRCDSNPCFRGVQCTDSRDGFQCGPCPE
GYTGNGITCIDVDECKYHPCYPGVRCINLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQ
VCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKAERNCRNPELNPCSVN
AQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQ
EDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFGDACDNCLSVLNNDQK
DTDGDGRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGDACDSCPDVSNPNQSD
VDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDL
VPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQT
VVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDY
AGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWH
TGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTT
MRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFDN
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgctggccccgcgcggagccgccgtcctcctgctgcacctggtcctgcagccgtggcta
gcggccggcgcccaggccaccccccagggtaagtgggctccggtcgggcccggaagcgcc
gggcaccgggtgccccatctgctgaattccaacgtgcttcttgcctgcttccactctact
cccaagtctgctttctctgtatgtgcctcacagcctgtcaggggctgtgaggaggtgtca
gataataaagaagcaagtggtggtgaccacgtcgacataagagatttcccgtctgactcc
tcccaccatctctgtaggtcacagaacctcacgccaactggctgtcttcagactgtggcc
aactggctgtcttcagactgtggtcaactggctgtcttcagactgtggtcaactggaaaa
tcgaccatcctccgttacctgaagaacgacgggaaggtgcatttggtggttttcaacaac
ctgcagctggcagacggaaggcggcacaggatcctcctgaggctgagcaatttgcagcga
ggggccggctccctagagctctacctggactgcatccaggtggattccattcacagtctc
cccagggcctttgctggcccctcccagaaacctgagaccattgaattgaggactttccag
aggaagccacaggacttcttggaagagctgaagctggtggtgagaggctcactgttccag
gtggccagcctgcaagactgcttcctgcagcagagtgagccgctgcctgccacaggcaca
ggggactttaaccggcagttcttgggtcaaatgacacaattaaaccaactcctgggagag
gtgaaggaccttctgagacagcaggttaaggaaacatcatttttgcgaaacaccatagct
gaatgccaggcttgcggtcctctcaagtttcagtctccaaccccaagcagcacagtggtg
cccccggcaccccctgcaccgccaacacgcccacctcgtcggtgtgactccaacccatgt
ttccgaggtgtccaatgtaccgacagcagagatggcttccagtgtgggccctgccccgag
ggctacacaggaaacgggatcacctgtattgatgttgatgagtgcaaataccatccctgc
tacccgggtgtgcgctgcataaatttgtctcctggcttcagatgtgacgcctgcccagtg
ggcttcacagggcccatggtgcagggtgttgggatcagttttgccaagtcaaacaagcag
gtctgcactgacattgatgagtgtcgaaatggagcgtgcgttcccaactcgatctgcgtt
aatactttgggatcttaccgctgtgggccttgtaagccagggtatactggtgatcagata
aggggatgcaaagcggaaagaaactgcagaaacccagagctgaacccttgcagtgtgaat
gcccagtgcattgaagagaggcagggggatgtgacatgtgtgtgtggagtcggttgggct
ggcgatggctatatctgtggaaaggatgtggacatcgacagttaccccgacgaagaactg
ccgtgctctgccaggaactgtaaaaaggacaactgcaagtatgtgccaaattctggccaa
gaagatgcagacagagatggtattggcgacgcttgtgacgaggatgctgacggagatggg
atcctgaatgagcaggataactgtgtcctgattcacaatgtggaccaaaggaacagcgat
aaagatatctttggggatgcctgtgataactgcctaagtgtcttaaataacgaccagaaa
gacacggatggggatggaagaggagatgcctgtgatgatgacatggatggagatggaata
aaaaacattctggacaactgcccaaaatttcccaatcgtgaccaacgggacaaggatggt
gatggtgtgggggatgcctgtgacagttgtcctgatgtcagcaaccctaaccagtccgat
gtggataatgatctggttggggactcctgtgacaccaatcaggacagtgatggagatggt
caccaggacagcacagacaactgccccaccgtcattaacagtgcccagctggacaccgat
aaggatggaattggtgacgagtgtgatgatgatgatgacaatgatggtatcccagacctg
gtgccccctggaccagacaactgccggttggtccccaacccagcccaggaggatagcaac
agcgatggagtgggagacatctgtgagtctgactttgaccaggaccaggtcatcgatcgg
atcgacgtctgcccagagaacgcagaggtcaccctgaccgacttcagggcttaccagacc
gtggtcctggatcctgaaggggacgcccagatcgatcccaactgggtggtcctgaaccag
ggcatggagattgtgcagaccatgaacagtgatcctggcctggcagtggggtacacggct
tttaatggagttgacttcgaagggaccttccatgtaaatacccagacagatgatgactat
gcaggctttatctttggctaccaagacagctccagcttctacgtggtcatgtggaagcag
acggagcagacatattggcaagccaccccattccgagcggttgcagaacctggcattcag
ctgaaggctgtgaagtctaagacaggtccaggggagcatctccggaactccctgtggcac
acgggggacaccagtgaccaggtcaggctgctgtggaaggactccaggaatgtgggctgg
aaggacaaggtgtcctaccgctggttcctacagcacaggccccaggtgggctacatcagg
gtacgattttatgaaggctctgagttggtggctgactctggagtcaccatagacacgaca
atgcgtggaggccgacttggcgttttctgcttctctcaagaaaacatcatctggtccaac
ctcaagtatcgctgcaatgacaccatccctgaggacttccaagagtttcaaacccagaat
ttcgaccgcttcgataattaa

DBGET integrated database retrieval system