KEGG   Pongo abelii (Sumatran orangutan): 100461962Help
Entry
100461962         CDS       T01416                                 

Gene name
GK2
Definition
(RefSeq) glycerol kinase 2
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100461962 (GK2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100461962 (GK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100461962 (GK2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100461962 (GK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 553 aa AA seqDB search
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEI
LQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQ
TTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSCSEIY
GLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSIWSLEPEALS
VLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTSQSPESGDPSIFSSLPLGFFIVSSM
VMLIGARYISGVP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagccccgaagacagcagctgtggggccgttggtgggagcggtggtccagggcacc
aactccactcgctttctggttttcaattcaaaaacagcggaactacttagtcatcacaaa
gtggaattaacacaagagttcccaaaagaaggatgggtggaacaagaccctaaggaaatt
cttcagtctgtctatgagtgtatagcaagaacgtgtgagaaacttgacgaactaaatatt
gatatatccaacataaaagctgttggtgtcagcaatcagagggaaaccactgtaatctgg
gacaagttaacaggagagcctctctacaatgctgtggtgtggcttgatctaagaacccag
actaccgttgaggatcttagtaaaaaaattccaggaaatagtaacttcgtcaagtctaag
acaggccttcccctcagcacttacttcagtgcagtaaaacttcgttggatgcttgacaat
gtgagaaacgtccaaaaggctgttgaagaaggtagagctctttttggcaccattgattca
tggcttatctggagtttgacaggaggagttaatggaggtgtgcattgtacagatgtaaca
aatgcaagcaggacaatgctttttaatatccattctttggaatgggataaagagctctgt
gacttttttgaaattccaatggaccttcttccaaatgtcttcagttgctctgagatctat
ggcctaattaaaactggggccctggaaggtgtgccaatatctgggtgtttgggggaccaa
tgtgctgcattagtaggacaaatgtgcttccaggagggacaagccaaaaacacctatgga
acaggttgcttcttactgtgtaatacaggtcgtaaatgtgtgttttctgaacacggcctt
ctgaccacagtagcttacaaactaggcagagagaagccagcatattatgcattggaaggt
tctgttgctatagcaggtgctgttattcgttggctaagagacaatcttggaattatagag
acctcaggagacattgaaaaacttgctaaagaagtaggaacttcttatggctgttacttt
gtcccagccttttcagggttatatgcaccttattgggagcccagtgcaagagggatactc
tgtggcctcactcagtttaccaataaatgtcatattgcttttgctgcattagaagctgtt
tgtttccaaacccgagagattttggaagccatgaaccgtgactgtggaattccacttcgt
catttgcaggtagatggaggaatgaccaacaacaaagttcttatgcaactacaagcagat
attcttcatattccagtaataaaaccctttatgcctgaaacaactgcactaggagctgcc
atggcagcaggggctgcagagggagtcagcatttggagccttgaacctgaggctttgtca
gttctcaggatggaacgatttgaaccacagatccaggccacagaaagtgaaattcgttat
gccacatggaagaaagccgtaatgaagtcaatgggttgggttaccagtcagtctcctgaa
agtggtgatccttctatcttctctagtctgcctttgggattttttatagtgagtagcatg
gtaatgctaattggagcaagatatatctcaggtgtaccataa

DBGET integrated database retrieval system