KEGG   Pongo abelii (Sumatran orangutan): 100462322Help
Entry
100462322         CDS       T01416                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100462322 (BAP1)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100462322 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 729 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANR
APAASEGTHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVPPNPTPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKG
KGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPT
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSVRPIQGSQGSSSPVE
KEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEIEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagcgacccaggcctcttcaccctgctcgtggaa
gatttcggtgtcaaaggggtgcaagtggaggagatctacgaccttcagagcaaatgtcag
ggccctgtatatggatttatcttcctgttcaaatggatcgaagagcgccggtcccggcga
aaggtctctaccttggtggatgatacgtccgtgattgatgatgatattgtgaataacatg
ttctttgcccaccagctgatacccaactcttgtgccactcatgccttgctgagcgtgctc
ctgaactgcagcaacgtggacctgggacccaccctgagtcgcatgaaggacttcaccaag
ggcttcagccctgagagcaaaggatatgcgattggcaatgccccggagttggccaaggca
cataatagccatgccaggcccgagccacgccacctccctgagaagcagaatggccttagt
gcagtgcggaccatggaggcgttccactttgtcagctatgtgcctatcacaggccggctc
tttgagctggatgggctgaaggtctaccccattgaccatgggccctggggggaggacgag
gagtggacagacaaggcccggcgggtcatcatggagcgtattggcctcgccactgcaggg
gagccctaccacgacatccgcttcaacctgatggcagtggtgcccgaccgcaggatcaag
tatgaggccaggctgcacgtgctgaaggtgaaccgtcagacagtactagaggctctgcag
cagctcataagagtaacacagccagagctgattcagacccacaagtctcaagagtcacag
ctgcctgaggagtccaagtcagccagcaacaagtccccactggtgctggaagcaaacagg
gcccctgcagcctctgagggcacccacacagatggtgcagaggaggcggctggttcatgc
gcacaagccccatcccacagccctcccaacaaacccaagctggtggtgaagcctccaggc
agcagcctcaatggggttccccccaaccccactcccattgtccagcggctgccggccttt
ctagacaatcacaattatgccaagtcccccatgcaggaggaagaagacctggcggcaggt
gtgggccgcagccgagttccagtccgcccaccccagcagtactcagatgacgaggatgac
tatgaggatgatgaggaggatgacgtgcagaacaccaactctgcccttaggtataagggg
aagggaacagggaagccaggggcattgagcggttctgctgatgggcaactgtcagtgctg
cagcccaacaccatcaacgtcttggctgagaagctcaaagagtcccagaaggacctctca
attcctctgtccatcaagactagcagtggggctgggagtccagctgtggcagtgcccaca
cactcgcagccctcacccacccccagcaatgagagtacggacacggcctctgagatcggc
agtgctttcaactcgccactgcgctcgcctatccgctcggccaacccaacgcggccctcc
agccctgtcacctcccacatctccaaggtgctttttggagaggatgacagcctgctgcgt
gttgactgcatacgctacaaccgtgctgtccgtgatctgggtcctgtcatcagcacaggc
ctgctgcacctggctgaggatggggtgctgagtcccctggcactgacagagggtgggaag
ggttcctcgccctccgtcagaccaatccaaggcagccaggggtccagcagcccagtggag
aaggaggtcgtggaagccacggacagcagagagaagacggggatggtgaggcctggcgag
cccttgagtggggagaaatactcacccaaggagctgctggcactgctaaagtgtgtggag
gctgagattgcaaactatgaggcgtgcctcaaggaagagatagagaagaggaagaagttc
aagattgatgaccagagaaggacccacaactatgatgagttcatctgcacctttatctcc
atgctggctcaggaaggcatgctggccaacctagtggagcagaacatctctgtgcggcgg
cgccaaggggtcagcatcggccggctccacaagcagcggaagcctgaccggcggaaacgc
tctcgcccctacaaggccaagcgccagtga

DBGET integrated database retrieval system