KEGG   Pongo abelii (Sumatran orangutan): 100462408Help
Entry
100462408         CDS       T01416                                 

Gene name
AGL
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pon00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 894 aa AA seqDB search
MGHSKQIRILLLNEMEKLEKTLFRLEQGYELQFRLGPTLQGKAVTVYTNYPFPGETFNRE
KFRSLDWENPTEREDDSDKYCKLNLQQSGSFQYYFLQGNEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLANQLE
LNPDFSRPNRKYTWNDVGQLVEKLKKEWNVICITDVVYNHTAANSKWIQEHPECAYNLVN
SPHLKPAWVLDRALWRFSCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWE
FFEVDVNKAVEQFRRLLTQENRRVTKSDPNQHLTIIQDPEYRRFGCTVDMNIALTTFIPH
DNGPAAIEECCNWFRKRIEELNSEKHQLINYHQEQAVNCLLGNVFYERLAGHGPKLGPVT
RKHPLVTRYFTFPFEEMDFSMEESMIHLPNKACLLMAHNGWVMGDDPLRNFAEPGSEVYL
RRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYML
DAARNLQPNLYVVAELFTGSEDLDNVFVTRLGISSLIREAMSAYDSHEEGRLVYRYGGEP
VGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSTTIVSMACCASGSTRGY
DELVPHQISVVSEERFYTKWNPEALPSNTGEVNFQSGIIAARCAINKLHQELGAKGFIQV
YVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEAR
TIERNTKPYRKDENSINGTPDITVEIREHIQLNESKIVKQAGVATKGPNEFIQEIEFENL
SPGSVIIFRVSLDPHAQVAVGILRNHLTQFSPHFKSGSLAVDNADPILKIPFAS
NT seq 2681 nt NT seq  +upstreamnt  +downstreamnt
atggggcacagtaaacagattcgaattttacttctgaacgaaatggagaagctggaaaag
accctcttcagacttgaacaagggtatgaactacagttccgattaggcccaactttacag
ggaaaagcagttaccgtgtatacaaattacccatttcctggagaaacatttaatagagaa
aaattccgttctctggattgggaaaatccaacagaaagagaagatgattctgataaatac
tgcaaacttaatctgcaacaatctggttcatttcagtattatttccttcaaggaaatgag
aaaagtggtggaggttacatagttgtggaccccattttacgtgttggtgccgataatcat
gtgctacccttggactgtgttactcttcagacatttttagctaagtgtttgggacctttt
gatgaatgggaaagcagacttagggttgcaaaagaatcaggctacaacatgattcatttt
accccactgcagactcttggactatctaggtcatgctactcccttgccaatcagttagaa
ttaaatcctgacttttcaagacctaatagaaagtatacctggaatgatgttggacagcta
gtggaaaaattaaaaaaggaatggaatgttatttgtattaccgatgttgtctacaatcat
actgctgctaatagtaaatggatccaggaacatccagaatgtgcctataatcttgtgaat
tctccacacttaaaacctgcctgggtcttagacagagcactttggcgtttctcctgtgat
gttgcagaagggaaatacaaagaaaagggaatacctgctttgattgaaaatgatcaccat
atgaattccatccgaaaaataatttgggaggatatttttccaaagcttaaactctgggaa
tttttcgaagtagatgtcaacaaagcggttgagcaatttagaagacttcttacacaagaa
aataggcgagtaaccaagtctgatccaaaccaacatcttacgattattcaggatcctgaa
tacagacggtttggctgtactgtagatatgaacattgcactaacgactttcataccacat
gacaatgggccagcagcaattgaagagtgctgtaactggtttcgtaagagaattgaggaa
ttaaattcagagaagcatcaactcattaactatcatcaggaacaggcagtgaattgcctt
ttgggaaatgtgttttatgaacgactggctggccatggtccaaaactaggacctgtcact
agaaagcatcctttagttaccaggtattttactttcccatttgaagagatggacttctcc
atggaagaatctatgattcatctcccaaataaagcttgtttactgatggcacacaatgga
tgggtaatgggagatgatcctcttcgaaactttgctgaaccgggttcagaagtttaccta
aggagagaacttatttgctggggagacagtgttaaattacgctatgggaataaaccagag
gactgtccttatctctgggcacacatgaaaaaatacactgaaataactgcaacttatttc
cagggagtacgtcttgataactgccactcaacacctcttcacgtagctgagtacatgttg
gatgctgctaggaatttgcaacccaatttatatgtagtagctgaactgttcacaggaagt
gaagatctggacaatgtctttgttactagactgggcattagttccttaataagagaggca
atgagtgcatatgatagtcatgaagagggcagattagtttaccgatatggaggagaacct
gttggatcctttgttcagccctgtttgaggcctttaatgccggctattgcacatgccctg
tttatggatattacacatgataatgagtgtcctattgtgcatagatcagcgtatgatgct
cttccaagtactacaattgtttctatggcgtgttgtgctagtggaagtacaagaggctat
gatgaattagtgcctcatcagatttcggtggtttctgaagaacggttttacactaagtgg
aatcctgaagcattgccttcaaatacaggtgaagttaatttccaaagcggcattattgca
gccaggtgtgctatcaataaacttcatcaggagcttggagccaagggttttattcaggtg
tatgttgatcaagttgatgaagacatagtggcagtaacaagacactcacctagcatccat
cagtctgttgtggctgtatctagaactgctttcaggaatcccaagacttcattttacagc
aaggaagtgcctcaaatgtgcatccctggcaaaattgaagaagtagttcttgaagctaga
actattgagagaaacacgaaaccttataggaaggatgagaattcaatcaatggaacgcca
gatatcacagtagaaattagagaacatattcagcttaatgaaagtaaaattgttaaacaa
gctggagttgccacaaaagggcccaatgaatttattcaagaaatagaatttgaaaacttg
tctccaggaagtgttattatattcagagttagtcttgatccacatgcacaagtcgctgtt
ggaattcttcgaaatcatctgacacaattcagtcctcactttaaatctggcagcctagct
gttgacaatgcagatcctatattaaaaattccttttgcttc

DBGET integrated database retrieval system