KEGG   Pongo abelii (Sumatran orangutan): 100462408Help
Entry
100462408         CDS       T01416                                 

Gene name
AGL
Definition
(RefSeq) glycogen debranching enzyme
  KO
K01196  glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100462408 (AGL)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100462408 (AGL)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     100462408 (AGL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: hDGE_amylase hGDE_central hGDE_N Alpha-amylase DUF4038 PglZ
Motif
Other DBs
NCBI-GeneID: 100462408
NCBI-ProteinID: XP_024089127
Position
1
AA seq 1532 aa AA seqDB search
MGHSKQIRILLLNEMEKLEKTLFRLEQGYELQFRLGPTLQGKAVTVYTNYPFPGETFNRE
KFRSLDWENPTEREDDSDKYCKLNLQQSGSFQYYFLQGNEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLANQLE
LNPDFSRPNRKYTWNDVGQLVEKLKKEWNVICITDVVYNHTAANSKWIQEHPECAYNLVN
SPHLKPAWVLDRALWRFSCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWE
FFEVDVNKAVEQFRRLLTQENRRVTKSDPNQHLRIIQDPEYRRFGCTVDMNIALTTFIPH
DNGPAAIEECCNWFRKRIEELNSEKHQLINYHQEQAVNCLLGNVFYERLAGHGPKLGPVT
RKHPLVTRYFTFPFEEMDFSMEESMIHLPNKACLLMAHNGWVMGDDPLRNFAEPGSEVYL
RRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYML
DAARNLQPNLYVVAELFTGSEDLDNVFVTRLGISSLIREAMSAYDSHEEGRLVYRFGGEP
VGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSTTIVSMACCASGSTRGY
DELVPHQISVVSEERFYTKWNPEALPSNTGEVNFQSGIIAARCAINKLHQELGAKGFIQV
YVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEAR
TIERNTKPYRKDENSINGTPDITVEIREHIQLNESKIVKQAGVATKGPNEFIQEIEFENL
SPGSVIIFRVSLDPHAQVAVGILRNHLTQFSPHFKSGSLAVDNADPILKIPFASIASKLT
LAELNQILYRCESEEKEDGGGCYDIPNWSALKYAGLQGLMSVLAEIRPKNDLGHPFCNNL
RSGDWMIDYVSNRLISRSGTIAEVGKWLQAMFFYLKQIPRYLIPCYFDAILIGAYTTLLD
TAWKQMSSFVQNGSTFVKHLSLGSVQLCGVGKFPSLPILSPALMDVPYRLNEITKEKEQC
CVSLAAGLPHFSSGIFRCWGRDTFIALRGMLLITGRYVEARNIILAFAGTLRHGLIPNLL
GEGTYARYNCRDAVWWWLQCIQDYCKMVPNGLDILKCPVSRMYPTDDSAPLPAGALDQPL
FEVIQEAMQKHMQGIQFRERNAGPQIDRNMKDEGFNITAGVDEETGFVYGGNRFNCGTWM
DKMGESDRARNRGIPATPRDGSAVEIVGLSKSAVRWLLELSKKNIFPYHEVTVKRHGKAI
KVSYDEWNRKIQDNFEKLFHVSEDPSDLNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPN
FTIAMVVAPELFTTEKAWKALEIAEKKLLGPLGMKTLDPDDMVYCGIYDNALDNDNYNLA
KGFNYHQGPEWLWPIGYFLRAKLYFSRLMGPETTAKTIVLVKNVLSRHYVHLERSPWKGL
PELTNENAQYCPFSCETQAWSVATILETLYDL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atggggcacagtaaacagattcgaattttacttctgaacgaaatggagaagctggaaaag
accctcttcagacttgaacaagggtatgaactacagttccgattaggcccaactttacag
ggaaaagcagttaccgtgtatacaaattacccatttcctggagaaacatttaatagagaa
aaattccgttctctggattgggaaaatccaacagaaagagaagatgattctgataaatac
tgcaaacttaatctgcaacaatctggttcatttcagtattatttccttcaaggaaatgag
aaaagtggtggaggttacatagttgtggaccccattttacgtgttggtgccgataatcat
gtgctacccttggactgtgttactcttcagacatttttagctaagtgtttgggacctttt
gatgaatgggaaagcagacttagggttgcaaaagaatcaggctacaacatgattcatttt
accccactgcagactcttggactatctaggtcatgctactcccttgccaatcagttagaa
ttaaatcctgacttttcaagacctaatagaaagtatacctggaatgatgttggacagcta
gtggaaaaattaaaaaaggaatggaatgttatttgtattactgatgttgtctacaatcat
actgctgctaatagtaaatggatccaggaacatccagaatgtgcctataatcttgtgaat
tctccacacttaaaacctgcctgggtcttagacagagcactttggcgtttctcctgtgat
gttgcagaagggaaatacaaagaaaagggaatacctgctttgattgaaaatgatcaccat
atgaattccatccgaaaaataatttgggaggatatttttccaaagcttaaactctgggaa
tttttcgaagtagatgtcaacaaagcggttgagcaatttagaagacttcttacacaagaa
aataggcgagtaaccaagtctgatccaaaccaacatcttaggattattcaggatcctgaa
tacagacggtttggctgtactgtagatatgaacattgcactaacgactttcataccacat
gacaatgggccagcagcaattgaagaatgctgtaactggtttcgtaagagaattgaggaa
ttaaattcagagaagcatcaactcattaactatcatcaggaacaggcagtgaattgcctt
ttgggaaatgtgttttatgaacgactggctggccatggtccaaaactaggacctgtcact
agaaagcatcctttagttaccaggtattttactttcccatttgaagagatggacttctcc
atggaagaatctatgattcatctcccaaataaagcttgtttactgatggcacacaatgga
tgggtaatgggagatgatcctcttcgaaactttgctgaaccgggttcagaagtttaccta
aggagagaacttatttgctggggagacagtgttaaattacgctatgggaataaaccagag
gactgtccttatctctgggcacacatgaaaaaatacactgaaataactgcaacttatttc
cagggagtacgtcttgataactgccactcaacacctcttcacgtagctgagtacatgttg
gatgctgctaggaatttgcaacccaatttatatgtagtagctgaactgttcacaggaagt
gaagatctggacaatgtctttgttactagactgggcattagttccttaataagagaggca
atgagtgcatatgatagtcatgaagagggcagattagtttaccgatttggaggagaacct
gttggatcctttgttcagccctgtttgaggcctttaatgccggctattgcacatgccctg
tttatggatattacacatgataatgagtgtcctattgtgcatagatcagcgtatgatgct
cttccaagtactacaattgtttctatggcgtgttgtgctagtggaagtacaagaggctat
gatgaattagtgcctcatcagatttcagtggtttctgaagaacggttttacactaagtgg
aatcctgaagcattgccttcaaatacaggtgaagttaatttccaaagcggcattattgca
gccaggtgtgctatcaataaacttcatcaggagcttggagccaagggttttattcaggtg
tatgtggatcaagttgatgaagacatagtggcagtaacaagacactcacctagcatccat
cagtctgttgtggctgtatctagaactgctttcaggaatcccaagacttcattttacagc
aaggaagtgcctcaaatgtgcatccctggcaaaattgaagaagtagttcttgaagctaga
actattgagagaaacacgaaaccttataggaaggatgagaattcaatcaatggaacgcca
gatatcacagtagaaattagagaacatattcagcttaatgaaagtaaaattgttaaacaa
gctggagttgccacaaaagggcccaatgaatttattcaagaaatagaatttgaaaacttg
tctccaggaagtgttattatattcagagttagtcttgatccacatgcacaagtcgctgtt
ggaattcttcgaaatcatctgacacaattcagtcctcactttaaatctggcagcctagct
gttgacaatgcagatcctatattaaaaattccttttgcttctattgcctccaaattaact
ttggctgagctaaatcagatcctttaccgatgtgaatcagaagaaaaggaagatggtgga
gggtgctatgacataccaaactggtcagcccttaaatatgcaggtcttcaaggtttaatg
tctgtattggcagaaataagaccaaagaatgacttggggcatcctttttgtaataatttg
agatctggagattggatgattgactatgtcagtaaccggcttatttcacgatcaggaact
attgctgaagttggtaaatggttgcaggctatgttcttctacctgaagcagatcccacgt
taccttatcccatgttattttgatgctatattaattggtgcatataccactcttctggat
acagcatggaagcagatgtcaagctttgttcagaatggttcaacctttgtgaaacacctt
tcattgggttcagttcaactgtgtggagtaggaaaattcccttccctgccaattctttca
cctgccctaatggatgtaccttataggttaaatgagatcacaaaagaaaaggagcaatgt
tgtgtttctctagctgcaggcttacctcatttttcttctggtattttccgctgctgggga
agggatacttttattgcacttagaggtatgctgctgattactggacgctatgtagaagcc
aggaatattattttagcatttgctggtacgctgaggcatggtctcattcctaatctactg
ggtgaaggaacttatgccagatacaattgtcgggacgctgtgtggtggtggctgcagtgt
atccaggattactgtaaaatggttccaaatggtctagacattctcaagtgcccagtttcc
agaatgtatcctacagatgattctgctcctttgcctgctggcgcactggatcagccattg
tttgaagtcatacaggaagcaatgcaaaaacacatgcagggcatacagttccgagaaagg
aatgctggtccccagatagatcgaaacatgaaggacgaaggttttaatataactgcagga
gttgatgaagaaacaggatttgtttatggaggaaatcgtttcaattgtggcacatggatg
gataaaatgggagaaagtgacagagctagaaacagaggaatcccagccacaccaagagat
gggtctgctgtggaaattgtgggcctgagtaaatctgctgttcgctggttgctggaatta
tccaaaaaaaatattttcccttatcatgaagtcacagtaaaaagacatggaaaggctata
aaggtctcatatgatgagtggaacagaaaaatacaggataactttgaaaagctgtttcat
gtttcagaagacccttcagatttaaatgaaaagcatccaaatttggttcacaaacgtggc
atatacaaagatagttatggagcttcaagtccttggtgtgactatcagctcaggcctaat
tttaccatagcaatggttgtggcccctgagctctttactacagaaaaagcatggaaagct
ttggagattgcagaaaaaaaattgcttggtccccttggcatgaaaactttagatccagat
gatatggtttactgtggaatttatgacaatgcattagacaatgacaactacaatcttgct
aaaggtttcaattatcaccaaggacctgagtggctgtggcctattgggtattttcttcgt
gcaaaattatatttttccagattgatgggcccggagactactgcaaagactatagttttg
gttaaaaatgttctttcccgacattatgttcatcttgagagatccccttggaaaggactt
ccagaactgaccaatgagaatgcccagtactgtcctttcagctgtgaaacacaagcctgg
tcagttgctactattcttgagacactttatgatttatag

DBGET integrated database retrieval system