KEGG   Pongo abelii (Sumatran orangutan): 100462435Help
Entry
100462435         CDS       T01416                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
Glycerolipid metabolism
Metabolic pathways
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100462435 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100462435 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100462435 (MGLL)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100462435 (MGLL)
Peptidases [BR:pon01002]
 Serine Peptidases
  Family S33
   100462435 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
3
AA seq 313 aa AA seqDB search
METGPEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHIFVRDVLQHVDSMQKD
YPGLPVFLLGHSMGGAVAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLV
LPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVP
FLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWV
SQRTATAGTASPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggacctgaagacccttccagaatgccagaggaaagttcccccaggcggacc
ccacagagcattccctaccaggacctccctcacctggtcaatgcagatggacagtacctc
ttctgcaggtactggaaacccacaggcacacccaaggccctcatctttgtgtcccacgga
gccggagagcactgtggccgctatgaagagctggctcggatgctgatggggctggacctg
ctggtgtttgcccacgaccatgttggccacggacagagtgaaggggagaggatggtagtg
tctgacttccacattttcgtcagagatgtgttgcagcatgtggattccatgcagaaagac
taccctgggcttcctgtcttccttctgggccactccatgggaggcgccgtcgccatcctc
acggccgcagagaggccgggccacttcgccggcatggtactcatttcgcctctggttctt
gccaatcctgaatctgcaacaactttcaaggtccttgctgcaaaagttctcaaccttgtg
ctgccaaacttgtccctcgggcccatcgactccagcgtgctctctcggaataagacagag
gtcgacatttataactcagaccccctgatctgccgggcagggctgaaggtgtgcttcggc
atccagctgctgaatgccgtctcgcgggtggagcgcgccctccccaagctgactgtgccc
ttcctgctgctccagggctctgccgatcgcctgtgtgacagcaaaggggcctacctgctc
atggagttagccaagagccaggacaagactctcaagatttatgaaggtgcctaccatgtt
ctccacaaggagcttcctgaagtcaccaactctgtcttccatgaaataaacatgtgggtc
tctcaaaggacagccacggcaggaactgcgtccccaccctga

DBGET integrated database retrieval system