KEGG   Pongo abelii (Sumatran orangutan): 100462476Help
Entry
100462476         CDS       T01416                                 

Gene name
PGAM2
Definition
(RefSeq) phosphoglycerate mutase 2
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00260  Glycine, serine and threonine metabolism
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon01230  Biosynthesis of amino acids
pon04922  Glucagon signaling pathway
pon05230  Central carbon metabolism in cancer
Module
pon_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pon_M00002  Glycolysis, core module involving three-carbon compounds
pon_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100462476 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100462476 (PGAM2)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100462476 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100462476 (PGAM2)
Enzymes [BR:pon01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100462476 (PGAM2)
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100462476 (PGAM2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100462476 (PGAM2)
  Exosomal proteins of melanoma cells
   100462476 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 100462476
NCBI-ProteinID: XP_002818052
Ensembl: ENSPPYG00000017599
UniProt: H2PM89
Position
7
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVL
KRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaccgcctcgtgatggtccggcacggcgagagcacatggaaccaggagaac
cgtttctgtggctggttcgatgcagagctgagtgaaaaggggaccgaggaggccaagcgg
ggagccaaggccatcaaggacgccaagatggagtttgacatctgctacacgtcggtgctg
aagcgggccatccgcaccctctgggccatcctggacggcacggaccagatgtggctgcct
gtggtgcgcacctggcgcctcaatgagcggcattatgggggcctcacaggcctcaacaag
gcggaaacggccgccaagcacggggaggagcaggtgaagatctggaggcgctccttcgac
atcccgccgcccccgatggacgagaagcacccctactacaactccattagcaaggagcgt
cggtacgcaggcctgaagcccggggaactgcccacctgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgaggagattgttccccagatcaaggctggcaagcga
gtgctcattgcagcccacgggaacagcctgcggggcattgtcaagcacctggaagggatg
tcagaccaggcgatcatggagctgaacctgcccacggggatccccattgtgtatgagctg
aacaaggagctgaagcccaccaagcccatgcagttcctgggtgatgaggaaacggtgcgg
aaggccatggaggctgtggctgcccagggcaaggccaagtga

DBGET integrated database retrieval system