KEGG   Populus trichocarpa (black cottonwood): POPTR_0001s06930gHelp
Entry
POPTR_0001s06930g CDS       T01077                                 

Gene name
POPTRDRAFT_847633
Definition
choline kinase family protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    POPTR_0001s06930g (POPTRDRAFT_847633)
Enzymes [BR:pop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     POPTR_0001s06930g (POPTRDRAFT_847633)
    2.7.1.82  ethanolamine kinase
     POPTR_0001s06930g (POPTRDRAFT_847633)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGI
AA seq 360 aa AA seqDB search
MGPVENPVNNKEYRIPGEAKEMLKSLASKWEDIDDANSLQVIPLKGAMTNEVFQIKWPTK
TQNMSRKVVVRIYGEGVEVFFDRDTEILTFEFMSKQGQGPRLLGRFSNGRIEEFIHARTL
SASDLHDPDISALIAAKMKEFHGLEMPGPKDVSLWHRLRLNWLKTAKSLCTPEEAKDFRL
DSIEDEISLIEKELSGDQSIGFCHNDLQYGNIMIDEETRSITIIDYEYASYNPIAFDIAN
HFCEMTADYHTDTPHILDYSKYPGLEERQRFLHLYLSSSGGLPSDIELEQLLENVEKYKL
ASHLFWGLWGIISEHVNEIDFDYMEYARQRFEQYCLRKPALLGSSGTTPDVALTDGNYTI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctgtagaaaatcctgtaaacaataaagaatataggataccaggagaggcaaag
gagatgttgaaatcgttggcatccaagtgggaagatattgatgatgcaaattcattgcag
gtgatccctttaaagggtgcaatgaccaatgaggttttccaaataaagtggccgacaaag
acacagaatatgtcgcgtaaggttgtagtcaggatctatggtgaaggagtggaggtgttt
tttgatcgagacactgagattcttacgtttgagttcatgtcgaagcaagggcagggacct
cgtttacttgggcggttctcaaatggacggattgaagagttcatccatgcacggacacta
tcagcctctgatctgcatgatccagatatatctgctcttatagcagctaaaatgaaggag
tttcatggtcttgagatgccaggtccaaaggatgtctctctgtggcacagattgcggtta
aattggctcaaaacagctaagagtttgtgtactccagaagaagctaaagactttcgcttg
gattccattgaggatgaaatttccttaattgaaaaggaactctcaggagatcaaagtata
gggttttgccataatgatttacaatatggcaacataatgattgatgaagagacaagatca
ataactataattgactatgagtatgcaagttacaaccctattgcttttgatatagcaaac
cacttctgtgagatgactgctgactatcatacagatacaccccatattttggactatagt
aaataccctggtttggaggagcgtcaaagatttcttcacttatatctgagttcctcaggt
ggtctacctagtgacattgaattggagcagctgctcgaaaatgttgagaagtataagctt
gcgagccatcttttttggggattatgggggataatatcggaacatgtcaacgaaattgac
tttgactacatggaatatgcaaggcagaggtttgaacagtactgtttaaggaagcctgct
ttattgggttcttcaggaaccacccctgatgtagctttgactgatggtaattatactatc
taa

DBGET integrated database retrieval system