KEGG   Populus trichocarpa (black cottonwood): POPTR_0001s08410gHelp
Entry
POPTR_0001s08410g CDS       T01077                                 

Gene name
POPTRDRAFT_548547
Definition
Leucoanthocyanidin dioxygenase family protein
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    POPTR_0001s08410g (POPTRDRAFT_548547)
Enzymes [BR:pop01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     POPTR_0001s08410g (POPTRDRAFT_548547)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MVTSSVLVPRVESLASSGIKSIPKEYIRPQEELNNIGNVFEEVKNNEGPQVPTIDLMEIE
SEDKVVREKCREEIVKAAKEWGVMHLVNHGIPDDLIDRVRKAGQAFFDLPIEEKEKYAND
QASGNVQGYGSKLANNASGQLEWEDYFFHLIFPEDKRDISVWPKTPSDYTKVTSEYARLL
RSLASKILSALSLGLGLEEGRLEKEVGGMEELLLQMKINYYPRCPQPELALGVEAHTDIS
ALTFILHNMVPGLQLFYEGKWVTAKCVPNSIIMHIGDTVEILSNGKYKSILHRGLVNKEK
VRISWAVFCEPPKEKIILKPLTEIVTEAEPPLFPPRTFAQHLAHKLFRKTQDSRTPPKAD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtgacttcatcagtgctagttccacgagttgagagtttggcaagcagtgggattaaa
tcaatcccaaaagaatatattcggccccaagaggagttaaataacatcggcaatgttttc
gaagaagtgaagaacaatgaagggcctcaagttccaaccattgatttgatggaaattgaa
tctgaggacaaagtggtccgggagaaatgccgggaagaaatagtcaaggcagctaaagag
tggggtgttatgcaccttgtcaaccatggaattcctgatgatttaatcgatcgtgtcagg
aaagctggccaggctttctttgatcttccaattgaggaaaaagagaagtatgctaatgat
caggcttcaggaaatgttcaagggtatggaagcaagctagctaacaatgccagtgggcag
cttgagtgggaggactattttttccatctcatttttcctgaggacaagcgtgacatctcc
gtatggcctaagacacctagtgattatactaaagtcactagtgaatatgcaaggctgctg
agaagtttagcgagcaaaattctgtcagcactatcacttggcctgggattggaagaagga
aggctagagaaggaggttggtggcatggaagagttactactccaaatgaagatcaactac
taccccaggtgccctcaaccagaactagctctaggggttgaagctcacacagatataagt
gcactcacttttatactccacaacatggtgcctggcctgcaactcttctatgaaggcaag
tgggtaacagcaaaatgcgtccccaactcaatcatcatgcacattggcgacactgttgag
atcttgagcaatgggaaatacaagagtattcttcacaggggacttgttaacaaggagaag
gtaaggatttcatgggcagttttttgcgagccgccgaaggagaaaatcatcctcaagcca
ctgacagaaattgtgactgaggctgagcctccattgttccctccacgcacctttgcacag
catcttgcgcataagcttttcaggaagacccaagattctcgcacccccccaaaagctgat
taa

DBGET integrated database retrieval system