KEGG   Populus trichocarpa (black cottonwood): POPTR_0001s21650gHelp
Entry
POPTR_0001s21650g CDS       T01077                                 

Gene name
POPTRDRAFT_548766
Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    POPTR_0001s21650g (POPTRDRAFT_548766)
   00500 Starch and sucrose metabolism
    POPTR_0001s21650g (POPTRDRAFT_548766)
Enzymes [BR:pop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     POPTR_0001s21650g (POPTRDRAFT_548766)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 558 aa AA seqDB search
MLGKLVVTGISLILVVGVIIGVVATVQRSGGSVEHTESLSPQMKAVSTLCQPTYYKEACT
NTLSAVNSTDPKELIKGGILAISDSLKKSSNLTDDLVVKNNSDEPRAKMALNDCKELLQD
ASEQLQDTLSKVGGIDLQSLSDHADDYRTWLSSIIAYQEMCLDGFEENSPLKAQVQNSTD
YGSQLTDNVLNILAGLSQVLGSLGLKFNAPSTSRRLLQADGYPSWMSAADRKLLASRGNG
GARPNAVVAHDGSGKFKTINAALAAYPKGLKGRYVIYVKAGIYREYVTVTKDKPNVFIYG
DGARRTIVTGNKNFAKDGIGTWKTATFIVEANGFIAKNMGFSNTAGPDGHQAVAIRVNSD
MSAFYNCRLDGYQDTLCYQAGRQFYRNCVLSGTVDFLFGYGSVVIQNSMIVVRRPNPSQF
NTVTADGRKERGQPGGIVIHNCRIVPEQKLVPVRFNIKTYLGRPWKAFSRTVVMETQLAD
FIQPDGWAPWSGNQFLDTLYYAEYANTGPGAATKRRVRWKTLHFLRRNEALQFTAGAFLR
GGQWIRNTGVPALLGLRR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgttaggcaaattagttgttacagggatttccctgatccttgtcgtgggtgtgatcatt
ggcgtggtggctactgtccaacgcagcggtgggtccgttgaacatacagagagcttgtct
ccgcaaatgaaggctgttagcacactgtgccagcctacttattacaaggaggcttgcacc
aacacccttagcgctgtgaactctaccgatcccaaagaactaatcaaaggaggcatatta
gccatctccgattcattgaagaaatcttccaatttgactgatgatctcgtagtcaagaac
aatagtgatgagccccgtgccaaaatggccttgaatgactgcaaagagttattgcaagat
gcttctgagcagctacaggacacattgtcaaaggtgggtggcattgatttacagtcgtta
tcagaccatgcggatgattatcgaacatggttgagctcaattattgcgtaccaagaaatg
tgcttagatggatttgaggaaaacagccccttgaaggctcaagtgcaaaatagcacggac
tatgggagccaactcacagacaacgttctgaatatccttgccgggctttcacaagttctt
ggttccttggggctcaagttcaatgctcccagcacctctcgtcggcttcttcaagctgat
ggttatcccagctggatgtctgctgctgaccgtaagcttttggcctcacgcggcaatggc
ggggcgagaccaaatgcagttgtggctcatgatggcagtgggaaattcaagactatcaat
gcagcgcttgccgcataccctaagggtctcaagggccgatatgttatctatgttaaggca
ggaatctatcgtgagtatgttactgtgaccaaggacaagcccaatgtgttcatctatggt
gatggagcccgcaggaccatcgtcactggaaacaagaactttgctaaagatggcataggc
acctggaagaccgctacatttattgttgaagcaaatggattcatcgccaagaacatggga
ttttccaacactgccggtcctgatggccaccaggctgttgcaatccgtgttaattcagat
atgtcagcattctacaactgcaggttggatggttatcaagacacattgtgttaccaagcc
gggcgccaattctaccgcaattgtgtcctttctggcacggtggacttcctctttggttat
ggatcagtggtgatccaaaactccatgatcgttgtccgaaggccaaaccctagccaattc
aacacggtgacggctgatggccggaaagagaggggacaacctggaggaattgtcattcat
aactgcaggattgtccctgagcagaaacttgtccccgtgaggttcaacatcaagacatac
ttgggtaggccatggaaggcattctctaggactgttgtgatggaaacacaactagcagac
ttcattcagcctgatggatgggccccatggagtggaaaccagtttcttgacactctttac
tatgctgagtatgccaacactggacctggagcagcaactaaaaggagggtcaggtggaaa
actcttcatttcctgagaaggaatgaagctcttcaattcactgccggtgcattccttcgt
ggtggtcaatggattagaaacaccggagttccagccttgcttggcctgagaagatga

DBGET integrated database retrieval system