KEGG   Populus trichocarpa (black cottonwood): POPTR_0001s25650gHelp
Entry
POPTR_0001s25650g CDS       T01077                                 

Gene name
POPTRDRAFT_172383
Definition
Josephin-like family protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     POPTR_0001s25650g (POPTRDRAFT_172383)
Peptidases [BR:pop01002]
 Cysteine Peptidases
  Family C86
   POPTR_0001s25650g (POPTRDRAFT_172383)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LGI
AA seq 202 aa AA seqDB search
MDSEKTEIYHEKQKLQFCLLHALNNLFQVLKNTNHPPLFLFFFSFIFQQQEAFTRARLNE
ISGKLVLDDPSKKTWTPLSIVFKPHHNAFTGNYDINVLIAALEEKDKTVVWHDRRNAAST
IDLDGADDSLFGIVLNVPARRYALLWKGRHWITMRKIGGVWYNLDSDLPKPMPFEGTREV
RGYLDYVLSNGGEVLLVMNKKE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgagaagaccgaaatctatcacgagaagcagaaattgcaattttgcctctta
catgccctcaacaatctcttccaggtactcaaaaatacaaatcacccacccctatttctt
tttttcttttcttttatttttcagcaacaggaggcatttactcgagcgagattgaatgaa
atttctgggaaacttgttcttgatgatcccagcaaaaagacttggacaccattgtctata
gtcttcaagcctcaccataatgcttttactggaaattacgacattaatgttttaattgcc
gctcttgaagagaaagacaagactgttgtctggcatgaccggcggaatgcagcttccact
attgatcttgatggggctgatgatagtttgtttggtattgtcctcaatgttccagctaga
cggtatgcattgctttggaagggtaggcattggattaccatgagaaagattggtggggtt
tggtataacttggatagtgatcttcctaagcctatgccctttgaaggtactcgagaggtt
aggggatatttggattatgttctaagtaatggtggagaggttttgcttgtcatgaacaag
aaagagtga

DBGET integrated database retrieval system