KEGG   Populus trichocarpa (black cottonwood): POPTR_0001s37680gHelp
Entry
POPTR_0001s37680g CDS       T01077                                 

Gene name
POPTRDRAFT_798160
Definition
sir2-like protein mRNA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
pop  Populus trichocarpa (black cottonwood)
Brite
Enzymes [BR:pop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     POPTR_0001s37680g (POPTRDRAFT_798160)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 464 aa AA seqDB search
MSLGYAEKLSYIEDVGNVGMSEFFDSSHVLQEKIERLAEMIQKSKHLVVFTGAGISTSCG
IPDFRGPKGIWTLQREGKPLPEASLPFHRAMPSMTHMALVELEKAGILKFIISQNVDGLH
LRSGIPREKLAELHGNSFMEVCPSCGVEYFRDFEVETIGLKETSRRCSDVKCGAKLKDTV
LDWEDALPTKEMLPAEKHCRMADVVLCLGTSLQITPACNLPLKCLRGGGKIIIVNLQKTP
KDKKASLVIHGFVDKVIAGVMNLLNLRIAPYVRIDLLQVIITQSLSLDERYVNWNLRVAS
IHALKAPLPFIESIEVSFTDAQKYKAAVLHDQPFNLKRRTAPAEAFEILLKLNFSDGCGC
PSIQINVPVNFKVSSDCFNLDKESAIQNLKERAIQDLCCGQNALIERKVILEPKTEVANH
ALVTNIKAFNSDSWSNGDVKHPRGVNGTKTSRKRSFGRKRKSRF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgggttatgcagaaaagctttcttacattgaagatgtgggcaacgttggaatg
tcagaattcttcgactcatctcatgttttgcaagaaaaaattgaaagacttgctgagatg
atacaaaagagcaagcatctagttgtgtttacaggtgcaggaatatcaacatcttgtggc
atacctgattttcgaggtcccaagggaatttggacgttacagcgcgagggaaaaccatta
cctgaagcatcgctaccatttcatcgagcaatgccaagcatgacacacatggctttggtt
gagctggagaaggctggcattttaaagtttattattagccagaatgtcgatggcctccat
cttcggtctggaataccaagggagaaacttgctgaattacatgggaattccttcatggaa
gtttgcccttcatgtggtgttgagtattttcgggattttgaggttgaaactattgggttg
aaggagacatcaagacgctgctctgatgtcaaatgtggagcaaagctaaaagatacagtt
cttgactgggaggatgcattgcccacaaaggagatgcttccagctgagaaacactgcagg
atggctgatgttgtattatgtttggggacaagtttgcaaatcactcctgcatgcaatctg
cctttaaaatgtctccgaggtgggggaaagattataattgtgaatcttcagaaaactccg
aaggataagaaggcaagtttggtgatccatggatttgtagacaaggttattgcaggggtc
atgaacttgctcaatttgaggattgctccatatgtcaggattgatcttcttcaagttatc
ataactcagtcattgagtttagatgaaagatatgtgaactggaacctccgggtggcaagt
atacatgcactgaaagcaccgttgccattcatcgagtccattgaggtgtccttcacagat
gctcaaaaatacaaagcggctgtgctacatgaccagccatttaacctaaaaaggaggact
gcaccagcagaagcatttgaaatcctcttgaaactcaacttcagtgatggatgtggttgt
ccctccatccaaattaatgtccctgtcaattttaaggtttcaagtgactgctttaacctt
gacaaggagtcggccatacaaaatctgaaggagagggcaattcaagatttgtgctgtggt
cagaatgcactgatcgaaagaaaggtcattttagagccaaaaaccgaggttgcaaaccat
gctttagtaaccaacattaaagctttcaattctgattcttggagtaatggtgatgtgaaa
catccaagaggggttaatgggaccaaaacatctcggaagcgatcgtttggtcgcaagcgt
aaatcgagattttag

DBGET integrated database retrieval system