KEGG   Populus trichocarpa (black cottonwood): POPTR_0001s40250gHelp
Entry
POPTR_0001s40250g CDS       T01077                                 

Definition
phosphoenolpyruvate carboxylase family protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pop  Populus trichocarpa (black cottonwood)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pop00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    POPTR_0001s40250g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    POPTR_0001s40250g
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    POPTR_0001s40250g
Enzymes [BR:pop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     POPTR_0001s40250g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 968 aa AA seqDB search
MAHSHARNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETV
QECYELSAEYEGKHDPKKLEELGSVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRR
RNKLKKGDFADENNATTESDIEETLKRLVSEMKKSPEEVFDALKNQTVELVFTAHPTQSV
RRSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMR
AGMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPE
VTRDVCLLARMMAANLYYSQIEDLMFELSMWRCSDELRLRADELHRSSKRDAKHYIEFWK
QIPPNEPYRVILGELRDKLYQTRERSRQLLSHGISEIPEEATFINVEQFLEPLELCYRSL
CSCGDRTIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYREWSE
ERRQEWLLSELRGKRPLFGPDLPKTEEISDVLDTFHVIAELPADNFGAYIISMATAPSDV
LAVELLQRECHVKQPLRVVPLFEKLADLEAAPAALVRLFSIDWYRNRINGIQEVMIGYSD
SGKDAGRFSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDT
IHGSLRVTVQGEVIEKCFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVV
ATEEYRSIVFKEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQ
TRFHLPVWLGFGAAFKHIIQKDIRNLHMLQEMYNAWPFFRVTIDLVEMVFAKGDPGIAAL
NDKLLVSEDLWAFGEKLRADYEETKGLLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNV
CQAYTLKRIRDPNYNVTTRPHISKEIMESSNPADELVKLNPTSEYGPGLEDTLILTMKGI
AAGMQNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggctcacagtcatgctaggaatctagagaagatggcatcgattgatgcacaacttagg
cttttggctcctggaaaagtgagtgaagatgacaaattgattgagtatgatgctctgctt
ttggatcggtttcttgacattcttcaagatttgcatggagaggatctcaaggaaacggtc
caagagtgctatgagctttctgctgagtatgaagggaagcatgatcccaagaaattggag
gagcttggaagtgtcctgactagtttggatcctggggactccattgttattgcgaagtct
ttctcccacatgcttaacctggccaatttggccgaagaagttcaaattgcttatcgtcga
cggaacaagttaaagaagggagactttgctgatgagaacaatgctactacagaatcagat
attgaagaaactctcaagagacttgttagtgaaatgaagaagtctcctgaagaagttttt
gatgctttgaagaatcagactgtagagcttgtctttactgctcatcctacgcaatcagtc
cgaagatctttgcttcaaaagcatgcaaggatacggaattgcttggctcagttgtatgcc
aaagatatcactcctgatgataagcaggagcttgatgaggctttgcagcgagagatccaa
gctgctttccgtacagatgagattcgaagaacccctccgactccccaagatgagatgagg
gctggaatgagctacttccatgagacaatctggaagggtgtcccaaagttcttgcgccgt
gttgataccgctttgaaaaacattggtattaatgaacgagttccttacaatgcccctctt
attcaattctcgtcttggatgggtggcgatcgtgatggtaatccaagggtaactcctgag
gtcacgagggatgtttgcttgttggcaagaatgatggctgctaacttgtattattcccaa
atagaggatctgatgtttgagttgtccatgtggcgctgtagtgatgagcttcgtcttcgc
gcagatgaactccacagatcctctaagagagatgcaaaacactacatagagttttggaaa
caaattcctccaaatgaaccctatcgtgtgattcttggtgagctgagggataagctgtat
cagacacgtgaacgctctcgtcaattgctatcccatgggatctctgaaattccagaggaa
gcaactttcataaatgttgagcagttcttggaacctttggaactctgttatagatcactg
tgctcttgtggtgaccgaacaattgctgatggaagccttctcgatttcttgaggcaagtc
tccaccttcggactttcattggtgagacttgacattagacaagagtctgatcgtcacact
gatgtcttagatgccattaccaagcacttggaaatcggttcctaccgagagtggtcagaa
gaacgaaggcaggaatggcttttatcagagctcagaggcaagcgcccactgtttggtcct
gatcttccaaaaacagaagaaatttctgatgtgttggacacgtttcatgtcatagctgaa
ctgccagcagataactttggagcatacatcatctctatggcaactgccccatcagatgtg
cttgcagttgagctccttcagcgtgaatgccatgtaaaacaaccattaagagttgttccc
ctatttgagaagcttgcagatctggaggcagctcctgctgctttggttcggcttttctca
atagattggtatagaaaccgtatcaatggaatacaagaagtcatgattggatactctgat
tctggcaaggatgctggaagattttctgcagcctggcagttatacaaggctcaagaggaa
cttataaaggtagctaagcaatatggtgtgaagctaacaatgttccatggccgaggtggg
actgttggaagaggaggtggtcccactcatcttgctatattgtctcagccaccagacact
attcatggttctcttcgtgtcactgttcaaggcgaagttattgagaaatgtttcggagag
gagcacttgtgctttagaacgcttcagcgttttacagctgccactcttgagcatggtatg
catcccccagtctcaccaaaaccagaatggcgagccctgatggacgaaatggcagttgtt
gcgacagaggagtatcgttctatagttttcaaagaaccacgatttgtggagtatttccgt
cttgccacaccagagatggagtatggtaggatgaacattggaagtcgtccatctaagaga
aagcctagtgggggaattgaatctctacgtgcgataccatggatctttgcctggacacaa
acaagattccatcttcctgtatggctaggctttggagcagcattcaaacatatcattcag
aaggacattagaaatctccatatgctgcaagagatgtacaatgcatggcctttctttagg
gtcaccattgatttggttgaaatggtgttcgccaagggagaccctggaatcgctgccttg
aatgacaaactccttgtttctgaggatctatgggcatttggcgagaagttgagggccgac
tatgaggaaaccaagggcctccttctccagattgctggacacaaggatcttcttgaagga
gacccttacttgaaacaaagactgcggctgcgtgattcatacatcacaaccctcaatgtc
tgccaggcctacacactgaaacggatccgtgatccaaactacaacgtaacaacacgacca
cacatatcaaaggaaataatggaatcaagcaatccagctgatgaactggtgaaactgaac
cctactagtgagtatggacctggtttggaggacactcttatcttgaccatgaagggtatt
gctgctggcatgcagaacactggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system